KEGG   Solibacillus silvestris StLB046: SSIL_0408Help
Entry
SSIL_0408         CDS       T02162                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00473  D-Alanine metabolism
siv00550  Peptidoglycan biosynthesis
siv01100  Metabolic pathways
siv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:siv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSIL_0408
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSIL_0408
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SSIL_0408
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:siv01011]
    SSIL_0408
Enzymes [BR:siv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SSIL_0408
Peptidoglycan biosynthesis and degradation proteins [BR:siv01011]
 Precursor biosynthesis
  Amino acid ligase
   SSIL_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: BAK14831
UniProt: F2F6D7
LinkDB All DBs
Position
446962..448035
Genome map
AA seq 357 aa AA seqDB search
MKKRIGLLYGGKSAEHEVSLSTAKAVTQALDFNEFDVFPIFITLKGEWRVGPQLTEPAQT
IEQLQFTTASDHSENNITQFIAKHMESPFDVIFPLLHGTNGEDGTVQGFLEVLNIPYVGN
GVLGSAAGMDKVVMKQLFEMAKLPQLPYEYFIRSEWEREKEAWIKRCEQSLGYPMFVKPA
NLGSSVGISKATNAAELEKAVQFALQYDRKIVIEQGVTAREIELAVLGNDTPNVSVAGEI
KPMTEFYDYDSKYKDGSTALIIPAPLQNDVYTNLVDMAKRAFKAIDGAGLVRADFFVTEN
NEIYINEVNTMPGFTPVSMYPLLWQHTDVTYPQLIKELIDFAVERYTEKQQLQYNRD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaattggtttattatatggtggtaagtcagccgagcatgaagtatcactt
tcaactgcaaaggcagtaacacaagcattggattttaatgagtttgacgttttcccgatt
tttattacattgaagggggaatggcgtgttggacctcagttaacagaacccgctcaaacg
attgaacaattgcaatttacaacagcatcagaccattctgaaaataatattacgcaattc
attgcaaaacatatggaaagtccatttgatgtaatcttccctttactgcatgggacgaac
ggtgaagacggaacagtacagggctttttggaagtactgaatattccttatgtagggaac
ggtgttcttggctctgcagcaggtatggataaggtagttatgaaacagttgtttgaaatg
gcaaaattgccgcaattgccttatgaatactttattcgaagtgaatgggagcgggaaaaa
gaagcttggatcaaaagatgcgaacaatctttaggttatccaatgttcgttaagccagct
aacttaggatcaagtgtagggattagcaaagcgacaaatgcagcggaactagaaaaagct
gttcaatttgcactccaatatgaccgcaaaattgtaattgaacagggcgtcactgcacgt
gaaattgagcttgctgtgttaggaaatgatacaccaaatgtttcagtagcgggtgagatt
aagccgatgactgagttttatgattatgattcaaaatataaagatggctcgacggcatta
attattccggcaccattacaaaacgatgtctatacaaacttggttgatatggcgaaaaga
gcattcaaagcaattgacggagccgggttagtacgcgcggatttcttcgtaactgaaaac
aacgaaatttacattaatgaagtaaatacgatgccaggattcacaccggtcagcatgtat
ccgttactgtggcagcatacagatgtaacatatccgcagttaattaaagagctgattgat
tttgcggtggaacgttatacagaaaaacaacagcttcaatacaacagagattga

DBGET integrated database retrieval system