KEGG   Solibacillus silvestris StLB046: SSIL_0498Help
Entry
SSIL_0498         CDS       T02162                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00970  Aminoacyl-tRNA biosynthesis
siv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:siv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSIL_0498
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:siv03029]
    SSIL_0498
Enzymes [BR:siv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SSIL_0498
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SSIL_0498
Mitochondrial biogenesis [BR:siv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SSIL_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF1939
Motif
Other DBs
NCBI-ProteinID: BAK14921
UniProt: F2F7J6
LinkDB All DBs
Position
555372..556817
Genome map
AA seq 481 aa AA seqDB search
MNFETVIGLEIHVELKTNSKIFSSSPNHFGAEPNTNTTVIDLGYPGVLPVLNKQVVDYAM
RASLALNMEIEQETKFDRKNYFYPDNPKAYQISQFDKPIGKNGWVEIEIPAKGDTPGYKK
KIGITRLHMEEDAGKLTHADGYSLVDLNRQGTPLVEIVSEPDIRTPDEAYAYLEKVKSII
QYTGVSDVRMEEGSLRCDANISIRPYGQEEFGTKTELKNLNSFNFVRRGLEHEEIRQAEV
LMAGGVIEQETRRFDEKTGKTILMRVKEGTDDYRYFPEPDLVRLSISDEWVERVRNEIPE
LPDARKARYVSELGLNDYDANVLVVNKEISDFFDATVNAGADAKLSANWLMGDISAYLNA
EQKELKNTALTPENLAGMVKLISDGTISSKIAKKVFTELVTNGGDAAKIVKEKGLVQISD
PEVIRGFVTTVLDNDAKSVEDFKAGKDRAIKALLGQIMKASKGQANPQLTNQILMEEINK
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacagtcattggcttagagattcacgttgagttaaaaacaaactcaaaa
atcttctctagcagtccaaaccactttggtgcggaaccaaacacaaatacaacagtaatc
gaccttggttatccaggtgttttaccagtattaaataaacaagtagtagattacgctatg
cgtgcttctttagcattaaacatggaaatcgaacaggaaactaagttcgaccgtaaaaac
tacttctatccggacaatccgaaagcttaccaaatttcacaatttgataagccaatcggt
aaaaacggttgggtagaaatcgaaattccagctaaaggtgatactccaggctacaaaaag
aaaatcggtattacacgtcttcacatggaagaagatgctggtaaactaacgcatgctgat
ggctattctttagtggacttaaaccgtcaaggtacgccattagtagaaatcgtttctgag
ccggatatccgcacgccagacgaagcgtatgcttatcttgaaaaagtaaaatcaatcatc
caatatacaggcgtttctgacgtacgtatggaggaaggttctcttcgttgtgatgcgaac
atttcaatccgtccatacggtcaagaagagttcggtacgaaaacggagcttaaaaactta
aactcattcaactttgtccgtcgtggtttagagcacgaagaaatccgccaagcagaagta
ttaatggctggtggcgttattgagcaggaaacacgccgttttgatgagaaaacaggtaaa
acaattcttatgcgtgttaaagaaggtacagatgattaccgttacttcccagagccggac
ttagtgcgtctttcaatttctgatgaatgggtagagcgcgtacgtaacgagattccagaa
ttaccggatgctcgtaaagcacgttatgtttctgaattaggcttaaatgattatgatgca
aacgtacttgtagtaaacaaagagatttcagatttctttgatgcaactgtaaacgcaggt
gctgatgcgaaattatcagctaactggttaatgggtgatatttctgcatacttaaatgca
gaacaaaaagagctgaaaaatacagctctaacaccggaaaacttggctggtatggtgaaa
ttaatttcggacggtacaatttcttctaaaatcgcgaaaaaagtattcactgagttagta
acgaatggtggagacgctgcgaaaattgtgaaggaaaaaggcttagttcaaatttctgat
ccggaagtaatccgtggtttcgtaacaactgttcttgataatgatgcaaaatcagtagaa
gacttcaaagctggtaaagaccgtgcgattaaagcacttcttggccaaattatgaaagct
tctaaaggtcaggcaaacccacaattaacaaaccaaatcttaatggaagaaattaataaa
cgttaa

DBGET integrated database retrieval system