KEGG   Solibacillus silvestris StLB046: SSIL_2744Help
Entry
SSIL_2744         CDS       T02162                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00061  Fatty acid biosynthesis
siv00780  Biotin metabolism
siv01100  Metabolic pathways
siv01130  Biosynthesis of antibiotics
siv01212  Fatty acid metabolism
Module
siv_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:siv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SSIL_2744
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SSIL_2744
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SSIL_2744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:siv01004]
    SSIL_2744
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SSIL_2744
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SSIL_2744
Lipid biosynthesis proteins [BR:siv01004]
 Fatty acid synthase
  Component type
   SSIL_2744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: BAK17167
UniProt: F2F6W9
LinkDB All DBs
Position
2803530..2804306
Genome map
AA seq 258 aa AA seqDB search
MDLLQLKGKNIVVMGVANERSIAWGIAKRLFDVGANVIFTYRKERSKGKIEKLLTNYEDH
NATVIECDVNSDVSIEKAFNQIGEQFKVIHGIIHSVAFAHAEDLHNRFVETTRDGYAFAQ
DTSAYSLIAVTKAAKPYMTEGGSIVTMSYLGAQRVLDGYNVMGVAKAALEASMRYLAADV
GAENIRVNAISAGAIRTLAAKGVPSFNQILHKIEETSPLKRNTNQEEVADMTIVMLSHLS
RGVTGETIYIDSGYNIMG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggatttattacaattaaaagggaaaaatattgtcgtaatgggtgttgccaatgagcgc
agtattgcttggggcatcgcaaagcgattatttgatgttggagcaaatgtaattttcaca
tatcggaaagaacgttcaaaaggaaaaatcgaaaagcttttaacaaattacgaagatcat
aatgcaacagttattgagtgtgacgtaaacagcgacgtaagcattgaaaaagcattcaat
caaattggtgagcaatttaaagtaattcatggcattatccactctgtagccttcgcacat
gccgaagacctgcacaaccgattcgtcgaaacaactcgtgatggctatgcctttgcacaa
gatacaagtgcttattcgctgattgctgtaacaaaagctgcaaaaccttatatgacagaa
ggcggctctatcgtaacgatgtcttatttaggtgcacagcgtgtgcttgacggctacaat
gtaatgggcgtcgctaaagcagcactcgaagcatcgatgcgctatttggcagcggatgtt
ggtgcagaaaatattcgtgtaaatgcgatttcagctggtgctatccggacattggcagca
aaaggtgtgccaagtttcaatcagatcctgcacaaaatcgaagaaacatctccgttaaaa
cgcaacacaaaccaggaagaagttgctgacatgacgattgtgatgttaagccatctatcc
cgcggtgtgactggcgaaacgatttatatcgatagcggttataatattatgggttag

DBGET integrated database retrieval system