KEGG   Solibacillus silvestris StLB046: SSIL_3579Help
Entry
SSIL_3579         CDS       T02162                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:siv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSIL_3579
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SSIL_3579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: BAK18002
UniProt: F2F9K4
LinkDB All DBs
Position
complement(3712172..3713653)
Genome map
AA seq 493 aa AA seqDB search
MKLLNFIGGEWIEDNSLQTMPVINPANGEQLGTIPLSTKFQVEIAAQKAKEAQKQWALVP
APKRADYLYEIAFKLKEKKEHLAQILTKEMGKVIEEARGEVQEGIDMALYMAAEGRRLFG
ETVPSELPNKFAMSVRAPIGVAGLITPWNFPIAIATWKSFPALVAGNTVIWKPSNETPFM
AYELAKIFEEVGLPPGVVNVVFGSGPTVGTAIVEHPDIRVISFTGSTTTGSKVAELGGKH
LKKVSLEMGGKNAVIVMDDANLDLALEGILWSAFGTAGQRCTACSRVIVHKNVKQELENR
LVEATKQLTIGDGLDPSVKVGPVINKAALEKINHYVQIGKQQGANLLIGGEILSEGELSK
GYYYAPTIFTDVEATSILAQEEIFGPVISIIEVSSLEEAIEVNNGVKFGLSSSIFSQDIN
KIFKAQQLLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGQAALDVYTEWKSIYVDY
SGKLQRAQIDNNA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttaaattttattggtggagaatggatagaagacaattcattgcaaacgatg
cctgtgatcaatcctgcaaatggtgaacagttaggaacgataccactttcgacaaaattc
caagtcgaaattgctgcacaaaaggcgaaggaggcccaaaaacaatgggcacttgtccct
gcgccaaagcgtgcggattatttatatgaaattgcatttaaactgaaagaaaagaaagaa
catcttgcgcaaatattaacgaaggaaatgggcaaggtcattgaagaagcacgcggggaa
gtgcaagaaggaatcgacatggcactttatatggcagcggagggaaggcgtttatttgga
gaaacggtcccgtcggaattgccgaataagtttgcgatgagtgtacgcgcaccgattgga
gtggctggacttattacgccgtggaatttcccgattgcaattgcaacatggaagtctttc
cctgcactcgttgccggtaatacggttatatggaagccttctaacgaaacaccttttatg
gcttacgagcttgccaaaatatttgaagaggtcggtttaccgcctggtgtcgtcaacgtt
gtattcggttccggtcctacggtgggaacagcaatcgtcgagcatccggacatccgtgta
atttcctttacagggtcaacaacgacaggaagcaaagtagccgagcttggcggaaaacat
ctgaagaaagtttcgcttgaaatgggcgggaaaaatgcggtcattgtaatggatgatgct
aatttggatttagcgcttgaaggtattttatggagtgcttttggtacggctgggcagcgc
tgtacagcatgcagccgtgtaatcgtgcataaaaatgtaaaacaggagttggaaaatcgt
cttgtggaagcaacgaagcagctgacaatcggagatggattggatccttcagttaaagtg
gggcctgtcattaataaggccgcactggaaaaaattaatcattatgtacagatcggtaag
cagcaaggcgcaaacttgctgattggcggagaaattttatcagaaggcgaattgtcaaaa
ggctattactatgccccgacaatttttaccgatgtggaggcaactagtattcttgcgcag
gaggaaattttcggtcctgttattagtattattgaagttagcagtttggaagaggcaatt
gaagtaaataacggtgtgaagtttggcttatcaagctcaattttctcacaagatattaac
aaaatcttcaaagcacagcagttgcttgatacaggaattgtttatgtaaatgccggtaca
acaggtgcggaaattcacttgccgtttggcggtacaaagggtacaggaaatggccaccgc
gattcagggcaggcagcgcttgatgtgtatacggaatggaagagtatttatgtagactac
agcggcaagttgcaacgtgcccaaatcgataataacgcttga

DBGET integrated database retrieval system