KEGG   Sinorhizobium sp. RAC02: BSY16_1060Help
Entry
BSY16_1060        CDS       T04514                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00010  Glycolysis / Gluconeogenesis
six00020  Citrate cycle (TCA cycle)
six00620  Pyruvate metabolism
six01100  Metabolic pathways
six01110  Biosynthesis of secondary metabolites
six01120  Microbial metabolism in diverse environments
six01130  Biosynthesis of antibiotics
six01200  Carbon metabolism
Module
six_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSY16_1060
   00020 Citrate cycle (TCA cycle)
    BSY16_1060
   00620 Pyruvate metabolism
    BSY16_1060
Enzymes [BR:six01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BSY16_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N DUF2118 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AOF88426
UniProt: A0A1B3M5P4
LinkDB All DBs
Position
1120149..1121489
Genome map
AA seq 446 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDTVKSGDVIAEIETDKATMEVEAVDEGVVAKIV
VPAGTEGVKVNSLIAILAADGEDVGAAAAGGGAAAPKAEAKTPEAPKEAEKPAAAAAAPA
ATASAGPAPAKDGNRVFSSPLARRIAKEAGVDISAVSGSGPHGRVVKSDVEKAVTSGGAK
PAAAAAPAAAASAAPAAAPKGMSEDAVLKLFEQGSYDLVPHDGMRKTIAKRLQESKQTIP
HFYVSVDVELDALLALRAQINGSAPEKDGKPAYKLSVNDMVIKAMALALRDVPDANVSWT
DSNMVKHKHADVGVAVSIPGGLITPIIRKAELKSLSAISNEMKDLGKRAKERKLKPEEYQ
GGTTAVSNMGMMGVSNFAAVVNPPHATILAVGAGTERVVVKKGQMVIVNAMTVTLSTDHR
AVDGALGAELLGAFKRYIESPMGMLV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcacgatgcccgccctgtcacctaccatggaagagggcaacctcgcc
aagtggctcgtcaaggaaggcgacaccgtgaaatccggtgacgtcatcgccgagatcgag
accgataaggcgacgatggaagtcgaagctgtcgacgagggcgttgtcgccaagatcgtc
gtgccggccggtacggaaggcgtgaaggtcaacagcctcattgccatcctcgccgccgat
ggcgaagatgttggcgctgccgccgctggtggcggtgctgctgctccgaaggcggaagca
aagacccccgaagcgccgaaggaagcggaaaagccggctgctgctgcagcggctcccgct
gcgaccgcctctgccggtccggctccggccaaggacggcaaccgcgtgttctcctcgccg
ctcgcccgccgcatcgccaaggaagccggtgtcgacatttcggcggtttccggttccggc
ccgcatggtcgcgtggtgaagagcgacgtcgaaaaggctgtcacctccggtggagccaag
cccgccgctgccgcagccccggctgctgctgcctcggccgctccggccgctgctccgaag
ggcatgtcggaagacgccgtgctcaagctgttcgagcagggctcctacgacctcgtgccg
catgacggcatgcgcaagaccattgccaagcgcctgcaggaatccaagcagacgatcccg
cacttctacgtctcggtcgatgtcgagctcgatgcgcttctggcgctgcgcgcccagatc
aacggttccgcaccggagaaggacggcaagccggcctacaaactctcggtcaacgatatg
gtgatcaaggccatggcacttgccctgcgcgatgtgccggacgccaacgtctcctggacc
gacagcaacatggtgaaacataaacacgccgatgtcggcgttgccgtgtcgatcccgggc
ggtctgatcaccccgatcatccgcaaggcggagctgaagagcctgtcggccatctccaac
gagatgaaggacctcggcaagcgcgccaaggaacgcaagctgaagccggaagagtaccag
ggcggcacgactgcggtctccaacatgggcatgatgggcgtctcgaatttcgccgccgtc
gtcaacccgccgcatgcgacgatcctggcggttggtgccggcacggagcgggtcgtggtc
aagaagggccagatggtaatcgtcaatgcgatgacggttacgctctccaccgaccaccgc
gccgtcgacggagcgctcggcgccgaactgctcggagccttcaagcgctacatcgaaagc
ccgatggggatgctcgtctga

DBGET integrated database retrieval system