KEGG   Sinorhizobium sp. RAC02: BSY16_1382Help
Entry
BSY16_1382        CDS       T04514                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSY16_1382
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:six02000]
    BSY16_1382
Enzymes [BR:six01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BSY16_1382
Transporters [BR:six02000]
 Other Transporters
  Pores ion channels [TC:1]
   BSY16_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AOF89995
UniProt: A0A1B3MA94
LinkDB All DBs
Position
1445428..1446063
Genome map
AA seq 211 aa AA seqDB search
MAEDLIFYANPMSRARIARWMLEEVGAPYRTEWLTFDGTMKSPEFLAINPMGKVPTIRHG
KTVVSEAAAICAYLADAFPDAGLAPPNDKRGDYYRWMFFAAGPLEMAVSLKAFALNVPKE
RERSIGCGSYESVMDALSFAVTQHPYVTGETFTAADVYVGAHISWGLQFGTLEARPEFQA
YWDRLKDRPASKRATAIDDEEMHRQLAAAKG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacctcattttctacgccaacccgatgtcgcgtgcgcgcattgcccgctgg
atgctggaggaggtcggcgcgccctaccgcacggagtggctgaccttcgacgggacgatg
aaatcgccggaatttctcgcgatcaacccgatgggcaaggtgccaaccatccggcacggc
aagaccgtcgtcagcgaagccgccgcgatctgcgcctatctggccgacgccttccccgac
gccggccttgcgccgccgaacgacaagcgcggcgactattaccgctggatgttctttgcc
gccgggccgctggaaatggcggtatcgctcaaggccttcgccttgaatgtaccgaaggaa
cgcgagcgcagcatcggttgcggcagctacgaatcggtgatggatgccctctccttcgcc
gtgacgcagcatccctacgtcaccggcgaaaccttcaccgccgccgacgtctatgtcggc
gcgcatatcagctggggcctgcaattcggcacgctggaggcccggccggaattccaggcc
tattgggaccgcctcaaggaccgaccggccagcaaacgcgcaaccgccatcgacgatgaa
gagatgcatcgccagcttgcggcggcgaagggctga

DBGET integrated database retrieval system