KEGG   Sinorhizobium sp. RAC02: BSY16_2393Help
Entry
BSY16_2393        CDS       T04514                                 

Gene name
argE
Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00220  Arginine biosynthesis
six01100  Metabolic pathways
six01110  Biosynthesis of secondary metabolites
six01130  Biosynthesis of antibiotics
six01210  2-Oxocarboxylic acid metabolism
six01230  Biosynthesis of amino acids
Module
six_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSY16_2393 (argE)
Enzymes [BR:six01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     BSY16_2393 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AOF89987
UniProt: A0A1B3MA46
LinkDB All DBs
Position
2466808..2467974
Genome map
AA seq 388 aa AA seqDB search
MIPSTPEILARLVAEPTVSRTSNLALLDYVEGLLRPVGAKIERFSHPDGSRANLWATIGP
DGPGGVVLSGHTDVVPVEGQDWSADPFTLVERDGRFYGRGAADMKGFVAAAVRAMLIASS
RPLKTPLHLALSYDEEIGCIGVRGLIDALAMRIERPALCIVGEPTGMRIATGHKGKLALR
ACCYGQEGHSALAPNALNALHLGASFITALQARQEDLSVKGARDADYDIPYSTIHAGMMR
GGTALNIVPNRCEIDFEIRNIAEDDPQDILTGIAADAEAIAAPFRNRFPMACIEIEQVSG
YPGLNAEPDAPVVRLLRRILDHDDPTLKVAFGTEGGLFNEILGISTAVCGPGFMEQGHKP
DEFVSADQLGRCDAMLARLVDLLEAGVA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatcccttcgaccccggaaatcctcgcccgtcttgtcgccgagccaacggtctcgcgg
acgtcgaacctcgcgctgttggattatgtcgagggcctgctccgtcccgtcggcgcaaag
atcgagcggttctcccatccggatggcagccgcgccaatctgtgggcgaccatcgggccg
gatggaccgggcggcgtggtgctttcggggcatacggatgtggtgccggtcgaaggacag
gactggagcgccgatccgtttaccctcgtcgagcgcgatggccggttttacgggcgtggc
gcggccgacatgaagggcttcgtcgcggcggcggtgcgggcaatgcttatcgcctcctcc
cggccgctcaaaacgccgctgcatctcgcattgtcctatgacgaggagatcggctgcatc
ggcgtgcgcggcctgatcgatgcgctggccatgcggattgaacggccggcgctgtgcatc
gtcggcgagccgacaggcatgcggattgccacgggccacaagggcaagctggcgctacgc
gcctgctgttatggacaggaagggcactcggcgctcgcgcccaatgcgctgaacgcgctg
catctcggcgccagcttcatcaccgcgcttcaggcgcggcaggaggacctgtcggtcaag
ggcgcgcgcgatgccgactacgacatcccctattccaccatccatgccggcatgatgcgc
ggcggcaccgcactcaacatcgtgccgaaccgctgcgagatcgacttcgagatccgcaac
attgccgaagacgacccgcaggacatcctcaccggcattgcggccgatgccgaggcgatc
gccgcgcccttccgcaaccgctttcccatggcctgtatcgagatcgagcaggtctccggc
tatccgggcctgaatgccgaaccggacgcgcccgtggtgcgcctgctgcggcgcattctc
gatcacgacgatccgacgctgaaagtcgccttcggcaccgagggcgggctgttcaacgag
atcctcggcatttccaccgccgtctgcggccccggcttcatggagcagggccacaagccg
gacgaattcgtcagcgccgatcaactcggccgatgtgacgctatgctggcgcggctggtc
gacctgctggaggctggcgtggcctga

DBGET integrated database retrieval system