KEGG   Sinorhizobium sp. RAC02: BSY16_293Help
Entry
BSY16_293         CDS       T04514                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00240  Pyrimidine metabolism
six01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSY16_293
Enzymes [BR:six01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BSY16_293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 AAA_30 AAA_22 YsaB FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AOF88378
UniProt: A0A1B3M5I3
LinkDB All DBs
Position
311794..312381
Genome map
AA seq 195 aa AA seqDB search
MAKLYFSYATMNAGKSTLLLQASYNYRERGMRTAIFIASFDDRAGQGRISSRIGLTSDAI
AFDYTDDLYRHIEELKGDGEGDIACVFIDEAQFLSEEQVWQLARVADRLSIPVMAYGLRT
DFQGKLFPGSKALLAIADEMREVRTICHCGRKATMVVRLGADGKVAKDGAQVEIGGNDKY
VSYCRRHWDDIMNAD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcagttacgcgacgatgaacgcgggcaagtcgacattgctcttg
caggcgtcctacaattaccgcgaacgcggcatgcgcacggcgatcttcatcgcctccttc
gatgatcgtgccggccagggccgcatctcctcgcgcatcgggctgacctcggatgccatc
gccttcgactacaccgacgatctctaccgccacatcgaagaactgaagggcgacggcgag
ggcgacatcgcctgcgtcttcatcgacgaggcgcagttcctttccgaagagcaggtctgg
cagcttgcccgcgtcgccgaccggctctccattccggtcatggcctatggcctgcgcacg
gattttcagggcaagctcttccccggttcgaaggcgctgctcgccatcgccgacgaaatg
cgcgaagtgcgcaccatctgccattgcggccgcaaggcgacgatggtcgtgagactcggc
gcagatggcaaggtggcaaaggatggcgcacaggtggaaatcggcggcaatgacaagtac
gtttcctattgccgccgccactgggacgacatcatgaacgccgattga

DBGET integrated database retrieval system