KEGG   Sinorhizobium sp. RAC02: BSY16_3569Help
Entry
BSY16_3569        CDS       T04514                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00564  Glycerophospholipid metabolism
six01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSY16_3569
Enzymes [BR:six01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSY16_3569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_3 FAD_oxidored FAD_binding_2 NAD_binding_8 3HCDH_N GIDA Mqo Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AOF88861
UniProt: A0A1B3M6X6
LinkDB All DBs
Position
3687503..3689020
Genome map
AA seq 505 aa AA seqDB search
MDGNVIRDIFVIGGGINGCGIARDAAGRGYSVVLAEMKDFASGTSSASTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPNVIWPMRFVLPFQKGGPRPAWLIRLGLFLYDYIGGRKL
LPATRTVDLAKDPAGGPLKKLFRKAFEYSDGWVDDARLVVLNARDAADRGADIRTGTKVV
TARRENGHWNVETENVETGTRETFRARMLVNAAGPWVDKVLSSAFGRNDVHNVRLVQGSH
IVVKKKFSDPRAYFFQNPDGRIIFAIPYQEEFTLIGTTDRDYQGDPRDVRISDAEIDYLC
ASASEYFAEPVTREDIVWTYSGVRPLFDDGASKAQEATRDYVLKIEGGDGQAPLLNIFGG
KLTTYRRLAESALEKISESIGAKGDRWTAQSRLPGGDFKVDGFDAEVKALSSRFAFLAPA
HARRLVRLYGTRAMAMLDGAKTIDDLGRHFGSDLYECEVRWLMKEEWARHAEDVLWRRTK
RGLHLSAAEAAALEDYMVAAQAAPH
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttggacggcaacgtgatccgcgatatttttgttatcggtggcggcatcaatggctgcggc
attgcacgcgatgctgcgggccgtgggtattcggtcgtgcttgccgagatgaaggacttt
gcgtccggtacgtcttccgcctcgaccaagctcattcatggcggcctgcgctatctcgaa
cattatgaattccgtctggtgcgcgaagcgttgatggagcgcgaagtgctctgggccatg
gcgccgaacgtcatctggccgatgcgtttcgtgctgccgttccagaagggcgggccgcgt
ccggcctggctcatccgcctcggcctgttcctctatgactatatcggtggccgcaagctt
ttgccggcaacccgcacggtggacctcgcgaaggaccccgccggtggcccgctcaagaaa
ctcttccgcaaggccttcgaatattccgacggctgggtcgatgatgcccgcctcgtcgtg
ctgaatgcgcgtgacgccgccgatcgcggcgccgacatccgcaccggcaccaaggtcgtg
accgcgcgtcgcgaaaacggccactggaatgtcgagacggagaatgtcgagaccggcacc
cgcgagacgtttcgcgcccgcatgctggtcaacgcggccggtccctgggtggacaaggtt
ctctcctccgccttcggccgcaacgatgtgcacaatgtccgcctcgtgcagggcagccat
atcgtcgtgaagaagaaattctccgatccgcgcgcctacttcttccagaacccggatggg
cgtatcatcttcgccattccctatcaggaagagttcacgctgatcggcacgaccgaccgg
gactatcagggcgatccccgagatgttcgaatcagcgacgcggaaatcgactatctttgt
gcttcggcgagcgaatatttcgccgagccggtgacgcgcgaggatatcgtctggacctat
tccggcgtgcgtccgctcttcgacgacggcgccagcaaggcgcaggaagccacgcgtgat
tacgtgctgaagatcgagggtggcgatggccaggcgccgttgctcaacatctttggcggc
aagctcaccacctaccggcgtctcgccgaatcggcgctggagaagatttcggaatcgatc
ggcgcgaagggcgaccgttggaccgcgcagtcccggctgcccggcggggacttcaaggtc
gatggtttcgatgccgaggtgaaggcactttcatcgcgttttgcctttctggcgcccgcc
catgcccgccggcttgtccggctctacggtacaagggcgatggcaatgctggacggtgcg
aagacgatcgacgatcttggacggcatttcggcagcgacctttacgagtgcgaagtgcgc
tggttgatgaaggaagaatgggcccggcacgcggaggacgtgctgtggcggcggaccaaa
cgcggattgcatctctcggctgcggaagcggctgcgctagaggactatatggtggccgcg
caggcggctccccactag

DBGET integrated database retrieval system