KEGG   Sinorhizobium sp. RAC02: BSY16_3626Help
Entry
BSY16_3626        CDS       T04514                                 

Definition
(GenBank) hypothetical protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00630  Glyoxylate and dicarboxylate metabolism
six00710  Carbon fixation in photosynthetic organisms
six01100  Metabolic pathways
six01120  Microbial metabolism in diverse environments
six01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:six00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSY16_3626
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BSY16_3626
Enzymes [BR:six01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BSY16_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AOF89362
UniProt: A0A1B3M8D9
LinkDB All DBs
Position
3756329..3757585
Genome map
AA seq 418 aa AA seqDB search
MIRLTYRIETPGSVEAMATKIASDQSTGTFVALPGETEELKARVAARVVAIRPLPPTDRA
SFPEEAGGATLFNRADVDIEFPMDAVGTDLSALMTIAIGGVFSIKGMTGIRIVDMKLPQE
FAAAHLGPQFGVPGSFALTGVKDRPIIGTIVKPALGLRPHETAEMVGELIEAGVDFIKDD
EKLMSPAYSPLKDRVAAIMPKIFDHEQKTGKKVMYAFGISHADPDEMMRNHDLVAAAGGN
CAVVNINSIGFGGIAFLRKRSSLVLHAHRNGWDVLTRHAGFGFEFSVWQQFWRLLGVDQF
QINGIRVKYWEPDESFVRSYKAVTTPLFFEGDVALPVIGSGQWGGQAPDTIAATGGSTDL
LYLCGGGIVSHPGGPGAGVKAVRQAWEAAVAGIPLETYAKDHAELAQSIEKFADGRAA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgtctgacctatcggatagagacccccggttcggtggaagcgatggcgacgaag
atcgccagcgaccagtcgaccggcaccttcgtggccttgcccggtgagacggaagaattg
aaggcgcgggtggcggcgcgtgtcgtcgcgatccgcccgctgccgccgaccgatcgtgcc
tcgtttccggaggaggcgggcggtgcgacgctgttcaatcgggccgatgtcgatatcgaa
ttcccgatggatgccgttggtaccgatctttccgcgctgatgaccatcgcgatcggcggc
gtcttttccatcaagggcatgacgggcatccgcatcgtcgacatgaagctgccgcaggaa
tttgccgccgcccatctgggtccgcagttcggcgtgccgggcagtttcgcgctgaccggc
gtgaaggaccgtccgatcatcggcaccatcgtcaagccggcgcttggtctcaggccgcat
gagacggccgagatggtcggcgaactgatcgaagcgggcgtcgatttcatcaaggacgac
gaaaaactgatgagcccggcctattcaccgctcaaggaccgggtggcggcgatcatgccg
aaaatcttcgatcacgagcagaagaccggcaagaaggtcatgtacgccttcggcatcagc
catgccgacccggacgaaatgatgcgcaaccacgatctggtggccgcggcgggcggcaat
tgcgccgtcgtcaacatcaactcgattggtttcggtggcatcgccttcctgcgcaagcgc
tccagtctcgtgctgcatgcccatcgcaacggctgggatgtcttaacgcgtcatgccggc
ttcggcttcgaattctccgtctggcagcagttctggcgcttgcttggcgtcgaccaattc
cagatcaatggcattcgcgtgaaatactgggagccggacgagagcttcgtgcgctcctac
aaggcggttaccacgccgctcttctttgaaggcgacgtcgcgctgccggtgatcggttcc
ggccagtggggcgggcaggcgcctgatacgattgcggcaacgggtggctcaaccgacctg
ctctatctctgcggtggcggcattgtcagccatcccggtgggccgggtgcgggtgtgaag
gcggtcaggcaggcctgggaggcggcggttgcgggcatcccgctcgagacctatgcgaag
gaccatgccgagcttgcgcaatccatcgaaaaatttgccgatggcagggcggcctaa

DBGET integrated database retrieval system