KEGG   Sinorhizobium sp. RAC02: BSY16_4937Help
Entry
BSY16_4937        CDS       T04514                                 

Definition
(GenBank) aminotransferase class I and II family protein
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
six  Sinorhizobium sp. RAC02
Pathway
six00220  Arginine biosynthesis
six00250  Alanine, aspartate and glutamate metabolism
six00270  Cysteine and methionine metabolism
six00330  Arginine and proline metabolism
six00350  Tyrosine metabolism
six00360  Phenylalanine metabolism
six00400  Phenylalanine, tyrosine and tryptophan biosynthesis
six00401  Novobiocin biosynthesis
six01100  Metabolic pathways
six01110  Biosynthesis of secondary metabolites
six01130  Biosynthesis of antibiotics
six01210  2-Oxocarboxylic acid metabolism
six01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:six00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSY16_4937
   00270 Cysteine and methionine metabolism
    BSY16_4937
   00220 Arginine biosynthesis
    BSY16_4937
   00330 Arginine and proline metabolism
    BSY16_4937
   00350 Tyrosine metabolism
    BSY16_4937
   00360 Phenylalanine metabolism
    BSY16_4937
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSY16_4937
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BSY16_4937
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:six01007]
    BSY16_4937
Enzymes [BR:six01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     BSY16_4937
Amino acid related enzymes [BR:six01007]
 Aminotransferase (transaminase)
  Class I
   BSY16_4937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 MukE
Motif
Other DBs
NCBI-ProteinID: AOF92874
UniProt: A0A1B3MII2
LinkDB All DBs
Position
pBSY16_1:980897..982108
Genome map
AA seq 403 aa AA seqDB search
MNMIVFESARASTIKSSPSMAVSMAAKAMRAKGEPVIDLSLGEPDFDTPAHIVDAAVDAM
RRGITRYTAPDGLPELREAIVRKFKRENGLDYALDEISIGNGAKQILFNAFLGTLEPGDE
VVVPAPYWVSYTDIVILHGGVPKIVVCGVEDDFKITPERLEAAITPKTRWFLFNSPSNPT
GAIYAADELKALGDVLARHPRVAVMSDEIYEHIVCGDVPFTSFANACPDLRDRTLLINGV
SKAYAMTGWRLGYAAGPKSLTKVLNKMQSQSTTCPSSITQVAAAAALNSPQDFVATAVAE
YKARGELVTTGFSAIPGLEVRAPEGAFYLFPKCAAHIGKTAPDGTVIDNDTALAAYLLRE
GKVATVPGAAFGVEPYIRLSFATSRDNLTLAIDRIADALARLR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgatcgtgtttgaaagcgcgcgggcatccacgataaaatcctcgccctctatg
gccgtttccatggcggccaaggccatgcgggcgaagggcgaacccgtcatcgatctgtcg
ctcggcgagccggacttcgacacgccggcccatatcgtggacgccgcagtggacgcgatg
aggcggggtattacgcgatacactgcaccggacggccttcccgagttgcgcgaggcgatc
gtcagaaaattcaagcgcgagaacggcctcgactatgccctggatgagatttccatcggc
aacggtgccaagcagatcctgttcaacgcctttctcggcacactggagcccggcgacgag
gtggtggtgccggcaccctactgggtctcgtatacagacatcgtcatcctgcacggcggc
gtgccgaagatcgttgtttgcggcgtggaggacgacttcaagatcacgccggagcgactg
gaagcggcgatcacgccgaagacccgctggttcctgttcaattcaccgtccaacccgacc
ggggcgatctacgccgccgacgaactgaaggcgctgggtgacgtgttggcgcgccatccc
cgcgtcgctgtcatgtcggacgagatctatgagcacatcgtctgcggtgatgtgcccttt
acgtcctttgcaaatgcctgcccggatctgcgcgaccgcacgcttctcatcaacggtgtc
tccaaggcctatgcgatgaccggctggcggcttggttatgcggcgggtccgaagagcctg
acgaaggtcctgaacaagatgcagtcgcagagcacgacgtgcccatcgtcgatcacgcag
gttgcggccgcggcggcgctcaatagcccgcaagatttcgtggcaaccgccgtcgctgaa
tacaaggcgcgcggcgaactcgtgacgacgggtttcagtgcgattcccggccttgaggtg
cgcgcgccggagggggctttctacctcttcccgaaatgcgccgctcatatcggcaagaca
gctccggatggcaccgtcattgacaacgatacggcgctcgccgcctacctgctgagggaa
ggcaaggtcgcgacagtgccgggcgccgccttcggcgtcgagccctatatccgcctgtcc
ttcgccacctcgcgcgacaatctcacgctcgccatcgaccgcatcgccgatgcactcgcc
cggcttcgctag

DBGET integrated database retrieval system