KEGG   Streptococcus iniae SFST01-82: SI82_04020Help
Entry
SI82_04020        CDS       T03674                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
siz  Streptococcus iniae SFST01-82
Pathway
siz00010  Glycolysis / Gluconeogenesis
siz00020  Citrate cycle (TCA cycle)
siz00620  Pyruvate metabolism
siz01100  Metabolic pathways
siz01110  Biosynthesis of secondary metabolites
siz01120  Microbial metabolism in diverse environments
siz01130  Biosynthesis of antibiotics
siz01200  Carbon metabolism
Module
siz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:siz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SI82_04020
   00020 Citrate cycle (TCA cycle)
    SI82_04020
   00620 Pyruvate metabolism
    SI82_04020
Enzymes [BR:siz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SI82_04020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B DUF2344
Motif
Other DBs
NCBI-ProteinID: AJG25769
UniProt: A0A023VQ92
LinkDB All DBs
Position
809907..811322
Genome map
AA seq 471 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMEIEAEETGVLLKIV
RQAGDAVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPNSADAAPAVAPKVETEVPEVAV
AKTAIPQEDGAKVRATPAARRVAAELGINLRQVAGTGPFGRVHQDDVENFKNAQPKASPL
ARKMAEAEGLDLADIKGSGYNGKVMKEDILAAILATKPAQETAKPAAAKEELKAELPEGV
EVIKMSAMRKAISKGMTNSYLTAPSFTLNYDIDMTEMMAFRKKLIDPIMNKTGLKVSFTD
LIGMAVVKTLMKPEHKFLNASLINDAQEIELHEFVNIGIAVGLDGGLIVPVVHGADKMSL
ADFVVASKDVIKKAQNGKLKSNEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATI
PTPTVVNGEIVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMENPFELLI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaaattataatgccaaaactcggtgttgatatgcaagaaggtgaaatcatc
gagtggaaaaaacaagaaggtgatgttgtcaacgagggcgatattcttcttgaaattatg
tctgataaaacaaatatggaaattgaagctgaggagacgggtgttcttttaaaaatcgtt
cgtcaagctggtgatgctgtccctgtaacggaagttattggttacattggagctgaagga
gagtctgtagacacgattgcttcaagtgaaaaaacaactgaaattccagttcctaactca
gctgatgcagcaccggctgttgcgccaaaagtagagactgaagttccagaagttgctgtt
gctaaaacagctatccctcaagaagatggtgccaaagttcgtgcaacacctgctgcaaga
cgtgtagctgcagaacttggtattaacttaagacaagttgctggaacaggtccatttgga
cgtgttcaccaagacgatgttgagaacttcaaaaatgctcaaccaaaagcgtcaccactt
gctcgtaagatggctgaagctgagggtcttgatttggctgacatcaagggaagtggttat
aatggcaaggttatgaaagaagatattcttgctgctattttagctacaaaacctgcacaa
gaaacagctaaaccagcagcagctaaagaagagcttaaagcagaattacctgaaggcgtt
gaagttattaagatgtctgcaatgcgtaaagcaatctctaaaggtatgactaactcatac
ttaacagctccgtcatttacattgaattacgatattgacatgacagagatgatggctttc
cgtaaaaaattaattgatccaatcatgaacaaaacaggtttgaaagtcagctttactgat
ttgattggtatggcagttgtcaaaacattaatgaaacctgagcataagttcctaaatgca
tcattaattaatgacgctcaagaaatcgaacttcatgaatttgttaatattggtatcgcc
gttggtttagacggtggacttattgtaccagttgtacacggtgcagacaaaatgtcactt
gctgattttgttgttgcttctaaagacgttatcaaaaaagcacaaaatggtaagttgaaa
tcaaacgaaatgtcaggatcaacattctcaattacaaacttgggaatgtttggaaccaag
acatttaacccaattattaaccaacctaattctgcaatccttggtgtaggtgcaacgatt
ccaacaccaacagttgttaatggtgaaattgttgcgcgtccaatcatggcaatgtgcttg
accattgaccaccgtatcgtagatggtatgaatggtgctaaattcatggttgatcttaaa
aacttaatggaaaacccatttgaattattaatctga

DBGET integrated database retrieval system