KEGG   Streptococcus iniae SFST01-82: SI82_06380Help
Entry
SI82_06380        CDS       T03674                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
siz  Streptococcus iniae SFST01-82
Pathway
siz00620  Pyruvate metabolism
siz00680  Methane metabolism
siz01100  Metabolic pathways
siz01120  Microbial metabolism in diverse environments
siz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:siz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SI82_06380
  Energy metabolism
   00680 Methane metabolism
    SI82_06380
Enzymes [BR:siz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SI82_06380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 FANCI_S1-cap
Motif
Other DBs
NCBI-ProteinID: AJG26212
LinkDB All DBs
Position
complement(1299931..1302651)
Genome map
AA seq 906 aa AA seqDB search
MTVNKLESRNNTEIIAEEVAILKEMLEESTRQMIGDEAFYNIQKILVLSENQDYTALESY
ISELTNDEMVIISRYFSLLPLLINISEDVDLAYEINLQNNTNVSYLGKLASTIEEVSKKE
DAQSILENVNVVPVLTAHPTQVQRKTVLELTNKIHDLLRKYRDVKTGIANRDKWLQELRR
YVDIIMQTDIIREKKLKVKNEITNVMEYYNASLIDAVTKLTSEYKALAQAKGLDLQNPKP
ITMGMWIGGDRDGNPFVTAETLRLSAKIQSEVIITYYIEKLSHLYRSFSLSNTLTKVSAE
VEQLAKLSQDQSIYRENEPYRKAFHYIQSRMVETLNALAPNSNKKRENTGLQVPAYQKAE
EFKADLVTICDSLQANGDGFLIKGDLQNLIQALDVFGFYLASIDLRQDSSIQEACVAELL
KAANIVDDYSSLSETKKCQILLKELMDDPRTLSSTTVPKSELLEKELAIYHAACEMKDLL
GEEVIKQHIISHTESVSDMFELAIMLKEAGLVDKDKARVQIVPLFETIEDLENSTAIMTE
FLSYDIVKKWIASKDNYQEIMLGYSDSNKDGGYLASGWTLYKAQNELTEIGQKNAIKITF
FHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGNKDVAYYNLEMLISA
SINRMVSRMLTNPDEIAGFRGIMDEIVEDSNLIYRSLVFENPHFYDYFFEASPIKEVSSL
NIGSRPAARKTITEISGLRAIPWVFSWSQNRIMLPGWYGVGSAFKHFIDKEEGNLAKLQH
MYKTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAENEEVRAVFHPILDEWQLTKDIILAI
EEHQELLEDNPSLKHSLDFRLPYFNVLNYIQIELIKRLRHNELDEDYEKLIHITINGIAT
GLRNSG
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtcaacaaactagaaagccgtaataataccgaaattatagcagaagaagtagct
attttaaaagaaatgttggaagaaagcactcgtcaaatgattggcgatgaggccttttat
aatattcaaaaaatccttgttttatccgaaaaccaagattacacagccttagaatcttat
atttctgagcttactaatgatgagatggttatcatttcacgctatttttcattgttacct
cttttgatcaatatttcagaggatgtggatttagcttatgaaattaaccttcaaaataat
actaatgtctcttatttaggaaagttggcttcaaccattgaagaagtttctaaaaaagaa
gatgctcagtccattttggaaaatgttaatgtggtacctgtgcttacagctcatccaact
caggttcagcgtaaaactgttcttgaattaaccaataaaattcacgatttgttacgcaag
tatcgtgatgttaaaacaggaattgcaaacagggataaatggttacaagaattgcgtcga
tatgttgatattatcatgcagactgacatcatccgtgaaaaaaaactcaaagtcaaaaat
gaaattacaaatgtcatggagtattacaatgcttcgttaattgacgccgttaccaaatta
acaagtgaatacaaagccttagcccaagcaaaagggcttgatttgcaaaatcctaaaccc
attacaatgggcatgtggataggtggtgaccgtgatggaaatccttttgtcactgctgaa
accttgagactttcggctaagattcaaagtgaggtgattatcacttactatattgaaaag
ttatcccatctctatagaagtttctcactgtcaaacactttaacaaaggttagtgcagaa
gttgaacaattagctaagttatcacaggaccaatctatctaccgtgaaaatgaaccttat
aggaaggcttttcattacattcaatcacgtatggtggaaaccctaaatgccctagcacct
aatagcaataaaaaaagagaaaacacaggtcttcaggtacctgcctaccaaaaagcggaa
gaatttaaggctgatttagtaaccatttgtgattcattgcaagcaaatggtgatggtttt
ttgattaaaggggatctccaaaatcttattcaagcacttgatgtttttgggttttacctt
gcaagtattgatttgcgtcaagactcaagtatccaggaagcttgtgttgcagagctatta
aaggctgccaacattgtggatgattatagctcgctaagtgaaacaaaaaaatgtcaaatc
cttctaaaagaattaatggatgacccgagaactttatcatcgacaactgttccaaagtca
gagcttcttgaaaaagaattagctatctatcatgctgcttgtgagatgaaagatttactg
ggtgaggaagttattaagcaacatatcatttcacatactgaaagtgtctcagatatgttt
gaacttgccatcatgcttaaagaagctggtcttgttgataaggataaggcccgtgttcaa
attgttcctctttttgaaaccattgaagacttggaaaattcaactgctattatgaccgaa
tttttaagttatgatattgtaaaaaaatggattgcttcaaaagataactaccaagaaatc
atgctaggttattctgatagcaataaagatggaggctatttagcttcaggatggacgctc
tataaagctcaaaatgaactaactgaaattggtcagaaaaatgccattaaaattaccttc
ttccatgggcgtggaggaacagttggccgaggtggtgggccttcttatgatgcgattacc
tcgcaaccttttggttccatcaaagatcgcattcgtttgactgaacaaggggaaatcatt
gaaaataaatatggcaataaagatgtagcctactataatttagaaatgcttatttcagca
tctatcaatcgaatggttagtcgtatgttgacaaatccagatgaaatagctggttttaga
ggcattatggatgagattgtcgaagatagtaatcttatttaccgttcattggtttttgaa
aacccacatttttatgattacttctttgaagcgagtccaatcaaagaggtttctagttta
aatattggctctaggcctgcagcacgaaaaaccatcacagagatttctggattacgtgcc
attccctgggtattttcatggtctcaaaatcggatcatgttgccaggatggtatggcgta
gggtctgccttcaaacactttattgataaggaagaaggaaaccttgccaaactccaacac
atgtataaaacctggccatttttccattcgcttctttcgaatgttgatatggtattgtca
aaatccaacatgaatattgcctttcaatatgctcagttagctgaaaatgaagaagttaga
gctgttttccatcccattttggacgaatggcaattgaccaaagatattattttggcaatt
gaggaacaccaagaattactggaagataatccttccttaaaacatagtttggatttcagg
cttccatatttcaatgtcttaaattatattcaaattgaattgattaagcgattgcgtcac
aatgaattggacgaagattatgaaaaattaattcatatcactattaatgggattgctaca
ggattgcgtaattccggttaa

DBGET integrated database retrieval system