KEGG   Streptococcus iniae SFST01-82: SI82_08455Help
Entry
SI82_08455        CDS       T03674                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
siz  Streptococcus iniae SFST01-82
Pathway
siz00220  Arginine biosynthesis
siz00250  Alanine, aspartate and glutamate metabolism
siz00290  Valine, leucine and isoleucine biosynthesis
siz01100  Metabolic pathways
siz01110  Biosynthesis of secondary metabolites
siz01130  Biosynthesis of antibiotics
siz01210  2-Oxocarboxylic acid metabolism
siz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:siz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SI82_08455
   00290 Valine, leucine and isoleucine biosynthesis
    SI82_08455
   00220 Arginine biosynthesis
    SI82_08455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:siz01007]
    SI82_08455
Enzymes [BR:siz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SI82_08455
    2.6.1.66  valine---pyruvate transaminase
     SI82_08455
Amino acid related enzymes [BR:siz01007]
 Aminotransferase (transaminase)
  Class I
   SI82_08455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AJG26600
UniProt: A0A385QBE0
LinkDB All DBs
Position
complement(1705183..1706397)
Genome map
AA seq 404 aa AA seqDB search
MKTFNKSSKLEDVAYDIRGPVLEEAERMMANGERILRLNTGNPAAFGFEAPDEVIHDLIV
NARQSEGYSDSKGIFSARKAIMQYCQLKKFPDVDIDDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLAGGKAVHYICDEEADWYPDIDDMKSKITAKTKAIVVINPNNP
TGALYPKEILEAIVELAREHGLILFADEIYDRVVMDGGEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKQHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDDLL
LPGGRIFEQRNFIYKAINDIPGLSAVKPQAGLYIFPKIDRHMYRIDDDEQFVLDLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPRVEELANVQEKITRVLHKYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtttaataaatcgtcaaagttagaagatgttgcctacgatattcgtggacca
gttttggaagaagcagaacgtatgatggcaaatggggaaagaatccttcgtttgaataca
ggaaatcctgccgcctttggttttgaagcaccagatgaagttatccatgatttaattgta
aatgctcgccaaagtgaggggtattctgatagtaaggggattttttcggcacgaaaagcc
attatgcagtactgtcagttaaagaagtttccagatgttgatattgatgatatttatcta
ggtaatggcgtttcagaactgatttccatgtctttacaagccttgcttgatgatggtgat
gaggttttggtgccgatgccggattatcctttgtggacagcttgtgttagtttagctgga
ggaaaggctgttcattatatctgtgatgaagaagctgattggtatccagatattgatgat
atgaagtcaaaaataactgcgaaaacaaaagctatcgttgttattaatcctaataatcct
actggagctctttatcctaaagaaatccttgaagctattgttgaacttgctagagaacat
ggtctaattctttttgctgatgaaatttatgaccgtgttgtcatggatggtggtgagcat
attgcaattgccagtttagcgccagatgttttttgtgtttctatgaatggtttgtcaaaa
tcacatcgcattgccggttttcgtgttggatggatggttttatctggtccgaaacaacat
gttaaaggttatattgaaggacttaatatgcttgctaacatgcgcttgtgttctaatgtt
ttggcgcagcaagttgtgcaaacctcgcttggtgggcgacaatctgtagatgatttattg
cttccaggtggccgtatttttgaacaaaggaactttatttataaagcgattaatgacatt
cctggattgtctgctgttaagccacaggcaggactttatatcttccctaaaattgaccgt
cacatgtatcgtattgatgatgatgagcaatttgttttggatttgctgaaacaagagaag
gtgatgttggtgcatggccgaggttttaactggaaagatcctgatcattttagaattgtt
tatctaccaagagtagaagaactggctaatgttcaagaaaaaattacccgtgtcctacac
aagtataaacgttaa

DBGET integrated database retrieval system