KEGG   Shewanella japonica: SJ2017_0694Help
Entry
SJ2017_0694       CDS       T04959                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sja  Shewanella japonica
Brite
KEGG Orthology (KO) [BR:sja00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SJ2017_0694
Enzymes [BR:sja01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SJ2017_0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO Thi4 AlaDh_PNT_C NAD_binding_7 Glutaredoxin FAD_binding_3 K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ARD21031
LinkDB All DBs
Position
825649..827256
Genome map
AA seq 535 aa AA seqDB search
MLDTNIKNQLNTYLQNLKRPVELVVSADASSKSQELLSLAQDIEGLSSLVSLQQQTSDRT
PSMSIKNPQNGSNITFAGLPMGHEFTSLVLALLHSGGHPIKLDADVIEQIRNLPGEFHFE
TYVSLSCQTCPEVVQALNMMAAINPNITNVMIDGALFQDEINDRNIMSVPTVYMNGEPFS
VGAISVVEILNKLDVNAVARKAEQLNNKESFDVLVVGGGPAGASAAIYAARKGLRTGVVA
DKFGGQVAETVGIENFISVSKTEGPKLVANLEAHVKDYDVDIMDNQRALSLKSGKQFELE
LESGAKLTSKTILLATGARWREMNVPGEQEYRGSGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVLEFDASLRADEVLQRKANSMGNIDIITQAMTTEVLGDGKRVTG
LTYTDRSTNESHNVELAGIFVQIGLVPNTEWLTDTVDLTPRGEIIVDGKGETSIPGVFAA
GDVTNSAYKQIIIAMGSGATASLGAFDYLIRHSDEAGNATDDTVEKALNSDTVAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttagatacgaatattaaaaatcaactgaatacctacctgcaaaacctcaagcgccca
gttgaacttgtcgtgtcagcagatgcaagctctaagtctcaagagttgttatcacttgct
caagatattgaaggtttatcatctttagtgagtttacagcagcaaacgtcggatagaacg
ccgtcaatgagcattaaaaatccacaaaatggatcaaatattacctttgctggtttacca
atggggcatgaatttacctctttagtgcttgcgttactgcactctggtggtcatccgatc
aaattagatgcggatgtgatcgaacagatccgaaacttacctggtgaattccatttcgaa
acctatgtgtcgttgagctgtcagacttgtcctgaagtggtgcaagcgttgaatatgatg
gctgcgatcaacccaaatattactaatgtgatgattgatggcgcattatttcaagatgaa
attaatgaccgcaatatcatgtctgtgcccacagtgtatatgaatggagagccgttctct
gttggcgcgatttctgttgtagaaatcttaaacaagttagatgtaaatgcagtagcaaga
aaagctgaacagttaaataacaaagaatcgtttgatgttttagttgttggtggtggccct
gctggcgcgtcagctgcgatatatgcagcgcgcaaaggacttcgcactggcgtagttgct
gataagtttggtggtcaagtggctgaaactgttggcattgaaaactttatttcagtgtct
aaaacagaaggccctaagctggtggctaaccttgaagcacacgttaaagattatgatgtc
gatatcatggataatcaacgtgctttgtcattaaagtcgggtaaacaatttgaactagaa
cttgaaagtggcgctaagctaacaagtaaaaccattttattagcaacgggtgcacgctgg
cgtgaaatgaatgtacctggtgagcaagaatatcgcggtagtggtgtagcttattgtcca
cattgtgatggcccattatttaaaggtaagcgtgttgcagtgattggcggtggtaattcc
ggcattgaagccgctattgacttagctggcatcgttgaacatgtcaccgtacttgaattt
gacgctagtttacgtgctgatgaagtcttgcagcgtaaagctaattcaatgggcaacatt
gacattattactcaagcaatgaccactgaagttttgggtgacggtaagcgtgtaacgggt
cttacgtatactgaccgcagcacaaacgaatctcataatgttgaactcgcgggtattttt
gttcaaattggtttagtacccaatacagagtggctaaccgataccgtagacttaactccg
cgtggtgagattattgttgatggtaaaggtgagacatctattcccggagtatttgcagct
ggcgatgtgactaactcagcttacaagcaaattatcattgcgatgggaagtggtgcaaca
gcatcattaggggcattcgattacttgattcgtcatagtgatgaagcaggtaacgcaact
gatgatactgttgagaaagcattgaactctgataccgttgctgcataa

DBGET integrated database retrieval system