KEGG   Shewanella japonica: SJ2017_1000Help
Entry
SJ2017_1000       CDS       T04959                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sja  Shewanella japonica
Pathway
sja00550  Peptidoglycan biosynthesis
sja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SJ2017_1000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sja01002]
    SJ2017_1000
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sja01011]
    SJ2017_1000
Enzymes [BR:sja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SJ2017_1000
Peptidases and inhibitors [BR:sja01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SJ2017_1000
Peptidoglycan biosynthesis and degradation proteins [BR:sja01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SJ2017_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CytoC_RC
Motif
Other DBs
NCBI-ProteinID: ARD21331
LinkDB All DBs
Position
complement(1207778..1208956)
Genome map
AA seq 392 aa AA seqDB search
MMKIVNTPLKSLLLLSAVSFSSQAANAPMVMPNAPTVAAKAYVLMDYNSGRIIAENNAYE
SLNPASLTKMMTSYVIGHEVKVGNISLDDEVTISKKAWSKNFPDSSKMFIEVGKKVTVED
LNRGIIIQSGNDACVAMAEHIAGTEDGFVDLMNSWSKQLGMTQSYFENSHGLDSDNHKTT
AYDMALLGAALIRDVPDEYRVYSEKSFTFNGIKQYNRNGLLWDNSLNVDGIKTGHTSGAG
YNLVSSATNDGMRLITVVMGTGSESARKAESKKLLNYGFRFFETITPYKAGDTFVTQKIW
YGDRETVDLGVVTDTPITINRGQAKNLQANFELTKPLSAPLAKGETVGRIFFQLNGKDIA
EFPLVTLNEVNEGSWFSKLMDYFKQMFEGWFG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaattgtaaacacaccgcttaaatctttgctgctgctttccgctgtatctttt
tcttctcaagcagccaacgcacctatggttatgccaaatgcgccaacggtagccgctaaa
gcttacgtattaatggattacaactctggccgcattattgctgaaaataatgcctatgag
tcacttaaccctgctagcttaaccaaaatgatgaccagctacgttattggtcatgaagtt
aaagttggcaacatttcgctggatgacgaagtaaccatcagtaaaaaagcatggtctaaa
aacttcccagattcgtcgaaaatgtttatcgaagtaggtaaaaaagtcactgttgaagac
ctaaaccgaggcattattattcaatcgggtaacgatgcttgtgtcgccatggctgagcat
attgccggaacagaagacggctttgtcgatttaatgaactcttggtcaaaacagctaggt
atgacccaaagttactttgaaaactcacacggtcttgattctgacaaccacaaaacaact
gcatacgacatggcattattaggtgctgcattaattcgtgatgtaccagatgaataccgt
gtttactctgaaaagtcatttacctttaacggtattaaacagtacaaccgtaatggcttg
ctatgggacaacagcttaaatgttgatggtattaaaacaggccacacttctggcgctgga
tataacctagtctcttctgcaaccaatgacggcatgcgtttaatcactgttgtgatgggt
acgggcagtgagtcagctcgtaaagcggaaagcaaaaagttacttaattatggtttccgt
ttctttgaaacgattaccccttataaagcgggtgacacctttgtaactcaaaaaatctgg
tatggcgatcgtgaaacggtagatttaggtgtggtcactgacaccccaattaccattaat
cgtggccaagctaaaaacttacaagctaacttcgagttaactaagcctttatctgcgcct
ttagctaaaggtgagacggttggccgtatcttcttccaacttaacggaaaagatattgct
gagttcccacttgttactcttaatgaagtgaacgaaggcagctggtttagtaaacttatg
gattacttcaagcaaatgtttgaaggttggtttggctaa

DBGET integrated database retrieval system