KEGG   Shewanella japonica: SJ2017_1004Help
Entry
SJ2017_1004       CDS       T04959                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
sja  Shewanella japonica
Pathway
sja00550  Peptidoglycan biosynthesis
sja01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SJ2017_1004
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SJ2017_1004
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sja01011]
    SJ2017_1004
Enzymes [BR:sja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SJ2017_1004
Peptidoglycan biosynthesis and degradation proteins [BR:sja01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SJ2017_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ARD21335
LinkDB All DBs
Position
complement(1212216..1214072)
Genome map
AA seq 618 aa AA seqDB search
MSPKKRIAMHDHAAEASLFKRRALFTFLCVFVLISILLSNLYQLQVVSFQDYETRSNDNR
IRVVPVAPSRGLIYDRHGQLLAENQPFYTLELIPEKAQGITESLDKLNEIIALTPDERES
ITERLRYHRRFKPLTIKSRLTEEQVATFSVNQHQFPGFRVEAGLKRHYPYEGLMTHVLGY
VGKINARDRASLESSGQWKNYAATNDIGKQGIEKFYESLLLGKPGHLEEEVNNRGRVIRT
LKVTPPTPGQDIYLTLDLKLQQKAMELLDGRRGSVVAIDPQDGGVLAMVSSPTYDPNLFV
HGISSKAYSALLNDKSRPLINRATQGQYSPASTIKPHVALLGLEEKTITEKTRIWDPGFW
QIPNVERKYRDWKRWGHGWVDVYSSIMDSCDTFFYDLAYKVGVDKIAQFMSQFGFGESTG
IDIYEEANGIMPSKDWKRMRYNQPWYIGDTISVGIGQGYWTTTPLQLTNAATILANHGQR
FTPHLLKSFKDETSKIDTPIDEQAPIVLDNDNNWEIINEAMRRTAHKSRFTDATYTAAMK
TGTAQVFSVAQDAKYDSETVAEHLRDNALIIAYAPYENPKIVLAVVLENAGWGGVNAGPV
ARALLDEYMLRDEWKVEE
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccaaaaaagcgcattgccatgcacgaccacgctgccgaggcgtcgctattcaaa
cgtcgtgctttgtttaccttcctgtgcgtatttgtcctaatcagtatcctgctgtctaat
ctataccaattgcaggttgtctctttccaagattacgaaacacgctccaatgataaccgt
attcgtgtggtgcctgttgcacctagtcgtggtcttatttatgacagacacggacagtta
ctggctgaaaaccaacctttttatacgttagaactgatcccagaaaaagcccaaggaata
actgagtcgctggataaactcaatgagatcattgcgctcaccccagatgaacgagaaagc
atcactgaaagattgcgttaccatcgccgctttaagccacttacaattaaatcccgtctc
actgaagaacaagttgccacatttagtgttaaccaacaccaatttcctggctttagagta
gaggcaggccttaaacgtcattacccatatgaaggcttaatgacccatgtattgggttat
gttggaaaaattaatgctcgtgaccgtgcttcacttgaaagctcaggacaatggaaaaac
tatgccgcaaccaatgacattggcaaacaaggcatcgaaaaattctacgaaagcttatta
ttaggtaaacctggccacttagaagaagaagtgaataaccgtggtcgagtgatccgtacc
ttaaaagtcaccccgccgacaccgggtcaagatatctacttaacattagatttaaaactg
cagcaaaaagccatggagttactcgatggtcgccgtggctctgttgtcgctattgacccg
caagatggtggtgttctcgccatggtttctagcccaacttacgaccctaatttattcgta
catggcattagttctaaagcctatagcgcattacttaatgataaatctaggcctttgatt
aaccgtgcaacacaaggtcaatattcacctgcatcgacgattaaaccccatgtcgcactg
cttgggctagaagaaaaaaccattaccgagaaaacccgtatttgggatcctggtttttgg
caaattccaaatgttgagcgtaagtaccgagattggaaacgttggggtcacggttgggta
gatgtgtatagttcaatcatggattcctgcgacacgtttttctatgatctcgcctataaa
gtcggtgtcgataaaattgcccagtttatgtcccaatttggttttggcgaatccactggc
atcgatatttacgaagaggccaacggcatcatgccttcaaaagattggaagcgcatgcgc
tataaccaaccttggtatattggtgacactatttcggtgggaattggccaaggctactgg
acaaccacgccattacagttaacgaatgctgccaccatattagccaatcatggacagcgc
ttcacacctcatttgttaaaatcatttaaagatgaaacatcaaaaattgatacaccgata
gatgagcaagccccaattgtgctcgataatgacaacaactgggaaatcatcaatgaagca
atgcgccgcacagctcacaaatctcgctttaccgatgctacttataccgcagcaatgaaa
accggtacggcgcaagtattcagtgtcgcacaagatgccaaatacgattctgaaaccgtt
gcagagcatttacgagataacgcattaatcattgcctatgccccttatgaaaacccgaaa
atagtcttagcagttgtacttgaaaatgctggctggggtggtgttaatgcagggccagtt
gcccgtgctctattggatgaatatatgttacgtgacgaatggaaggtagaagaatga

DBGET integrated database retrieval system