KEGG   Shewanella japonica: SJ2017_1216Help
Entry
SJ2017_1216       CDS       T04959                                 

Definition
(GenBank) guanylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
sja  Shewanella japonica
Pathway
sja00230  Purine metabolism
sja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SJ2017_1216
Enzymes [BR:sja01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     SJ2017_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc
Motif
Other DBs
NCBI-ProteinID: ARD21543
LinkDB All DBs
Position
complement(1442951..1443976)
Genome map
AA seq 341 aa AA seqDB search
MVFSHGRICLFSLFTSPELPQWAMGKSDLATLAIFMGFVFGCLHWMSNLIADFSAISRLP
YIFSVIFKGLFLLLGAMTLAYVTQFLNMWAIENHLVTLRQMLTAHILYSPSFQALIIYLV
AVRVGLAFIEQMALLVGPRVLMNIGLGKYHQPRYEHRLFPFVDMVSSTAHAETLGDYRFS
RLIQDSFSMLADTVTDNDAEIYRYMGDAVLIHWPLEDGIKQDRCMNIYYEFSQQLNWHRP
YFEEHYGFVPKFKAAAHCGQVVAAVVGVQKQEISFFSDVLNTLARLQDQCNPLGQRMLIS
GEVAHRLERQDSRFELSDLGAMKLKGKKHEIEVYGVSPKKP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttagccatgggcgcatttgtcttttttcgttattcacaagccctgaactcccc
caatgggctatgggaaaatcagaccttgccacattagccatcttcatgggttttgtgttt
ggttgtctgcattggatgtcgaatttaatcgctgactttagtgcaatcagtcgtttaccc
tatatcttctcagttatttttaaaggcttgtttctactgttaggcgcaatgacgcttgcc
tatgttacccaattcctcaatatgtgggctattgaaaatcatcttgtcacgctaagacaa
atgctcacagctcacatcctttatagtccttcttttcaagcattaatcatatatctagtc
gctgtacgtgtaggccttgcctttatcgaacaaatggcactacttgtgggccctcgtgta
ttgatgaacattggcttaggtaagtaccatcagccaagatatgaacatcgactattcccc
tttgttgatatggtatcttcaactgcgcacgctgaaacactaggcgactatcgctttagt
cgattaattcaagacagttttagtatgctggctgatacagtaactgataatgatgctgaa
atttatcgctatatgggtgatgcagttttaattcattggcctcttgaagatgggatcaag
caagatcgctgtatgaatatttactacgaatttagccaacaacttaactggcatcgacct
tactttgaagaacactatggctttgtgcctaaatttaaagcggcagctcattgcggccaa
gttgttgctgccgtggttggtgttcaaaagcaagaaattagctttttcagtgatgtgtta
aataccttggcaagactacaagaccaatgtaatccgctaggtcaaagaatgcttatttct
ggggaagttgcacaccgcctagaaagacaagatagtcgatttgagttatcagatttaggc
gccatgaagctcaaaggcaaaaagcatgaaattgaagtgtatggtgtgagccctaaaaaa
ccctaa

DBGET integrated database retrieval system