KEGG   Shewanella japonica: SJ2017_1533Help
Entry
SJ2017_1533       CDS       T04959                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sja  Shewanella japonica
Pathway
sja00250  Alanine, aspartate and glutamate metabolism
sja00410  beta-Alanine metabolism
sja00430  Taurine and hypotaurine metabolism
sja00650  Butanoate metabolism
sja01100  Metabolic pathways
sja01110  Biosynthesis of secondary metabolites
sja01120  Microbial metabolism in diverse environments
sja02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SJ2017_1533
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SJ2017_1533
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SJ2017_1533
   00430 Taurine and hypotaurine metabolism
    SJ2017_1533
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SJ2017_1533
Enzymes [BR:sja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SJ2017_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Helicase_C_3 Peptidase_S80
Motif
Other DBs
NCBI-ProteinID: ARD21852
LinkDB All DBs
Position
complement(1821354..1823006)
Genome map
AA seq 550 aa AA seqDB search
MTTKNDRKAQASEDSLLRIFTVPEDAESTLSIIEQKLSEDLAGFLGKSIAALEKPLSLIE
QDFRTFQIPDAPRFVSDYTDEIMQNLVAHSVHTSAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYGQNDSFYEQWMHSANYSLGAFCSGGTVANIT
ALWIARNQLLKADGHFKGINREGLPKALKHYGFEDIAILVSERGHYSIGKTADLLGIGRD
NIISIPTTADNKVDVTKMRQTAKQLASDNIKVMAIVGVAGTTETGNIDPLAELAELAREL
DCHFHVDAAWGGASLLSNKYRYLLDGIEQADSVTIDAHKQMYVPMGAGMVLFKDPELANA
IAHHAEYILRVGSKDLGSQTLEGSRPGMAMLVHACLQIIGGDGYEILINNSLEKARYFAD
CIVEHRDFELITHPELCILTYRFVPHSVQQAIDDAVERGDVKFVTTCNELLDGLTQFIQK
HQREQGKSFVSRTRIKPAKYLRKDTTVFRVVLANPLTTETILKDVLAEQSDIAQLDKQYL
PRLLELCKVT
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaccactaagaacgaccgcaaagcccaagcatctgaagatagtctattacgtattttt
accgtaccagaagatgcagaatcaacgttaagtatcattgaacaaaagctctctgaagat
ttagcgggattcttgggtaaaagcattgcagctttagagaaacctttatcactgattgaa
caagacttcaggacatttcagatccctgatgccccacgctttgtttctgattatactgat
gaaatcatgcaaaacttggtcgctcactcagtacatacctctgccccgagctttatcggt
catatgacttcggcattaccatattttgtactgccactgtctaaaatgatggttggcctg
aatcaaaacttggtcaaaattgaaacttcaaaagctttcaccccgcttgaacgtcaagtc
ttgggcatgatgcaccaccttatatatggccaaaatgattcgttttatgaacagtggatg
catagtgcaaactactctttaggcgccttttgttctggtggaaccgttgccaatatcact
gcactgtggattgcacgcaaccaattattgaaagcagatggacattttaaaggcataaac
cgtgaaggtttacccaaggccttaaaacattatggttttgaggacatcgccatactggta
tctgaacgcggccattactccattggaaaaaccgctgatttgttaggaatcggtcgtgat
aatatcatcagtattccaaccacagctgacaataaagttgatgttacaaaaatgcgtcaa
acagccaaacagctagccagtgacaatataaaagtcatggcaattgttggcgtagcgggt
actactgaaacaggtaatattgatcccttagctgagcttgctgagttagcacgagaactt
gattgtcactttcatgtggacgcggcatggggtggcgcaagtttattatcaaacaaatat
cgctatttgcttgatggtatagaacaagctgactctgtcacaatcgatgcccataaacaa
atgtacgttcctatgggcgcgggtatggtgttatttaaagatccggaacttgccaatgcc
attgctcatcacgctgaatatattttacgtgtcggctctaaggacttagggagtcaaacc
cttgaaggctcaagacctggtatggctatgttagtccatgcctgtttgcaaattattggc
ggtgacggctatgaaattttaatcaataacagccttgaaaaagcccgctactttgctgac
tgtattgtcgaacacagagactttgagcttattactcaccctgaattgtgcattttaacc
tatcgatttgtaccgcactcagtacaacaagctattgatgatgccgtggaacggggtgac
gttaagtttgtcacaacatgtaatgaacttctcgatggcttaacccaattcattcaaaag
catcaacgtgaacaaggtaaatcattcgtgtcacgtactcggataaaaccagccaaatat
ctgcgtaaagacaccacagtatttagagttgttttagctaatccgcttaccactgaaacc
atattaaaagacgtgttagcggaacaaagcgatattgcacagcttgataagcagtatctg
ccacgcttgctagaattgtgcaaagttacctaa

DBGET integrated database retrieval system