KEGG   Shewanella japonica: SJ2017_2256Help
Entry
SJ2017_2256       CDS       T04959                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sja  Shewanella japonica
Brite
Enzymes [BR:sja01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SJ2017_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARD22546
LinkDB All DBs
Position
2703278..2703862
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALAPHISEETIEYHYGKHHNTYVVKLNGLVEGTEFANKTLEEVVKTS
TGGMFNNAAQIWNHTFYWNCLAPNAGGAPTGPIADAINAAFGSFEEFKAKFTDSAVNNFG
SAWTWLVKNADGTVSIVNTSNAATPLTDESVTSLLTVDVWEHAYYIDYRNVRPNYMAAFW
ELVNWDFVNANFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattaccagcattaccatatgctaagaacgcacttgcaccacacatttct
gaagagactattgaatatcactacggtaagcatcacaacacttacgttgttaagcttaat
ggtcttgttgaaggtactgaatttgctaacaaaacattagaagaagttgttaaaacttct
actggtggcatgttcaacaacgctgctcaaatctggaaccacactttctactggaactgt
ttagctccaaatgctggcggcgcacctactggtcctatcgctgatgcaattaacgcagct
ttcggttctttcgaagagttcaaagctaagtttacagattctgctgtaaacaacttcggt
agcgcttggacttggttagtaaaaaatgctgacggtactgtttctattgttaacactagc
aatgctgctactccgttaactgacgagtcagtaacatcactactaacagttgatgtttgg
gaacatgcttactacatcgattaccgtaacgttcgccctaactacatggctgcgttctgg
gaacttgttaactgggatttcgttaacgcaaacttcgcgggttaa

DBGET integrated database retrieval system