KEGG   Shewanella japonica: SJ2017_2433Help
Entry
SJ2017_2433       CDS       T04959                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sja  Shewanella japonica
Pathway
sja00020  Citrate cycle (TCA cycle)
sja00190  Oxidative phosphorylation
sja00650  Butanoate metabolism
sja01100  Metabolic pathways
sja01110  Biosynthesis of secondary metabolites
sja01120  Microbial metabolism in diverse environments
sja01130  Biosynthesis of antibiotics
sja01200  Carbon metabolism
Module
sja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sja_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sja_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SJ2017_2433
   00650 Butanoate metabolism
    SJ2017_2433
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SJ2017_2433
Enzymes [BR:sja01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SJ2017_2433
    1.3.5.4  fumarate reductase (quinol)
     SJ2017_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4 Fer4_9
Motif
Other DBs
NCBI-ProteinID: ARD22723
LinkDB All DBs
Position
complement(2896828..2897535)
Genome map
AA seq 235 aa AA seqDB search
MKLEFAVYRYNPDVDTKPYMKDYSLEVEEGTDMMVLDALMKLKESDPELSFRRSCREGVC
GSDGVNMNGKNGLACITPVSTFKGKKIEIRPLPGMPVVRDLIVDLTQFYTQYEKIKPFLI
NDEKTPAREHLQSPEERAHLDGLYECIMCACCSTACPSFWWNPDKFIGPSGLLHAYRFLI
DSRDTATEERLAGLDDAYSVFRCHGIMNCVDVCPKGLNPTKAIGHIKSMLLKRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggaatttgcagtttatcgctacaatcctgatgtagatactaagccttatatg
aaagattacagcttagaagtggaagaaggtaccgatatgatggtactggatgcactgatg
aagctgaaagagtcagaccctgagttatcatttagacgctcatgccgtgaaggcgtttgt
ggtagtgatggcgtgaacatgaatggtaaaaatggtctagcgtgtattacgcctgtttct
acttttaagggtaagaaaattgaaatccgtcctttaccaggcatgcctgtagtgcgtgat
ttaattgttgacctgactcagttctacactcagtacgaaaaaattaagccgtttcttatc
aatgatgagaaaaccccggctcgtgaacatttacaatcacctgaagagcgcgctcattta
gatggtttgtacgaatgtatcatgtgtgcttgttgttctactgcttgtccatcgttctgg
tggaatccggataaatttatcggtccaagtggtttattgcatgcttaccgcttcttgatt
gatagtcgtgatacggcaactgaagaacgtctagctggtttagatgatgcttacagtgtg
ttccgttgtcatggcatcatgaactgtgttgatgtttgtcctaaaggattaaacccaact
aaagcaattggccatattaagtcaatgctattgaagcgagcagtataa

DBGET integrated database retrieval system