KEGG   Shewanella japonica: SJ2017_2434Help
Entry
SJ2017_2434       CDS       T04959                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sja  Shewanella japonica
Pathway
sja00020  Citrate cycle (TCA cycle)
sja00190  Oxidative phosphorylation
sja00650  Butanoate metabolism
sja01100  Metabolic pathways
sja01110  Biosynthesis of secondary metabolites
sja01120  Microbial metabolism in diverse environments
sja01130  Biosynthesis of antibiotics
sja01200  Carbon metabolism
Module
sja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sja_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sja_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SJ2017_2434
   00650 Butanoate metabolism
    SJ2017_2434
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SJ2017_2434
Enzymes [BR:sja01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SJ2017_2434
    1.3.5.4  fumarate reductase (quinol)
     SJ2017_2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like GIDA Pyr_redox_2 DAO FAD_binding_3 Thi4 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ARD22724
LinkDB All DBs
Position
complement(2897547..2899313)
Genome map
AA seq 588 aa AA seqDB search
MAIPVREFDAVVIGAGGAGMRAALQISKEGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDFIGDQEAIEFMCKTGPEAVIELEQMGLPFSRFENGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKHKTEVFSEWYALDLVKNDDGAIVGC
TAIEIETGEIVYFKSKATILATGGAGRIYASTTNAHINTGDGVGMAMRAGVQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGLDGPLGPHCLLKLDHLGKETLEARLPGVCELSRTFAHIDPADGPIPVLPTCHYMMGGL
PAKVSGQVVRQNEDGSEQDIVGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGQHLG
KALDETADPKAPSEEQIAASLDRLNRWESNKEGEDPAVIRKDLQLCMQLNFSVFRSGDAM
AEGLKELKKIRERLANAKLSDNSSEFNTQRIECLELDNLMATAIATAYAANFRTESRGAH
SREDFLDRDDDNWLCHSVFDPVTEQMTKREVNMEPKLRDAFPPIKRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtggctattccagttcgcgaatttgacgcagtagtgatcggcgctggtggcgctggcatg
cgagcggctttacaaatttctaaagaaggtaagagctgtgcgcttttatctaaagtattc
ccaacgcgttctcatacggtttctgcgcaaggtggtatcactgttgcgttaggtaacgcc
catgaagatcactgggaacagcacatgtacgataccgtgaaaggttctgattttatcggc
gaccaagaagcgattgagtttatgtgtaagacaggtccagaggcggttatcgaacttgag
caaatgggtcttccattctcacgtttcgaaaacggcactatttaccagcgtccatttggt
ggccaatcaaagaactttggtggcgaacaagcggcacgtactgcagcagcagctgaccgt
acaggtcatgctttgcttcattgcttataccaacaaaacgttaaacacaaaactgaagtg
ttttctgaatggtatgcattagatttagttaaaaacgatgacggcgcaattgtgggttgt
actgcaattgaaatcgaaactggcgaaattgtttactttaagtcgaaggcaacaatttta
gcaacaggtggtgcagggcgtatttacgcttctactaccaatgctcacattaacactggt
gacggtgttggtatggcaatgcgtgctggtgttcagatgcaagacatggaaatgtggcaa
ttccacccaacgggtattgctggcgcaggtgtgcttgtaactgaaggttgtcgtggtgaa
ggtggttatcttttaaataaagatggcgaacgcttcatggagcgttacgctcctaacgca
aaagatttggcttctcgtgacgtcgttgctcgttcaatgatgactgagatccgtgaaggt
cgtggattagatggtccattaggcccgcactgtttacttaaacttgatcacttaggtaaa
gaaacattagaagcgcgtcttcctggtgtttgtgaactttctcgtacgtttgcgcatatt
gatccagcagatggcccaatccctgtattgccaacatgtcactacatgatgggtggtcta
cccgctaaagttagtggccaagttgttcgccaaaacgaagatggttcagagcaagatatc
gtaggcttatttgcagttggtgagattgcttgtgtatcagtacatggtgcaaaccgctta
ggtggtaactcactgcttgatttagtggtatttggtcgtgctgcaggtcagcatttaggt
aaagcgttagatgagactgctgatcctaaagcaccttcagaagagcaaattgctgcttca
cttgatcgtcttaatcgctgggaaagcaataaagaaggtgaagatcctgcagtaatccgt
aaagacttacagttatgtatgcagcttaacttctctgtatttagaagtggcgatgcaatg
gctgaaggccttaaagagcttaagaagatccgtgaacgtttagctaacgccaagttatct
gataattcttcagaatttaatactcaacgtattgagtgtttagagttagataacttaatg
gctacagctattgcaactgcttatgctgctaacttccgtacagaaagccgtggtgcgcat
tctcgtgaagatttcttagaccgtgatgacgataattggttatgtcacagtgtctttgat
cctgtcactgaacaaatgactaagcgtgaagtcaacatggagcctaagcttcgtgatgca
ttcccgcctatcaagcgtacttactag

DBGET integrated database retrieval system