KEGG   Shewanella japonica: SJ2017_2522
Entry
SJ2017_2522       CDS       T04959                                 

Definition
(GenBank) Ion transport protein
  KO
K10716  voltage-gated potassium channel
Organism
sja  Shewanella japonica
Brite
KEGG Orthology (KO) [BR:sja00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sja02000]
    SJ2017_2522
Transporters [BR:sja02000]
 Other transporters
  Pores ion channels [TC:1]
   SJ2017_2522
SSDB
Motif
Pfam: Ion_trans Ion_trans_2 DZR PKD_channel zinc_ribbon_2 zf-tcix zf-ribbon_3 zinc-ribbons_6 NinF HypA Nudix_N_2 DZR_2
Other DBs
NCBI-ProteinID: ARD22812
LinkDB
Position
complement(3002166..3003014)
AA seq 282 aa
MTSEEKQDTPLKRHIRSVIFGTETKLGRWFDIGLIICILFSVLLIILDTIDSYHQQYGQA
IYYAEWAFTWLFTIEYLLRLYGSINRWAYMRSFYGIVDLLSILPSFLALIFPGANVSLAF
RILRLFRVFRVLKLLRYLSEGNLLLKAMIQSRRKVFIFFFSVSLIIMALSVVMYVVEGPG
NGFTSIPKSMYWTIVTITTVGYGDITPQTNLGQAIASLTMLIGYSIIAIPTGILTAEISH
EMVAERDLRKCSNCGTRGHNLQALFCHHCGSELEQHQSEGKS
NT seq 849 nt   +upstreamnt  +downstreamnt
atgacgtcagaagaaaagcaagacacgccattaaaacggcatatacgttctgtcattttt
ggcacggaaactaagctaggtcgatggtttgatatcggactcatcatttgtattttattc
agtgtattactgataattttagataccatcgacagttatcatcaacaatatggccaagca
atttactatgctgaatgggcgtttacttggctatttacgattgaatacttgttgcggctt
tatggctcaatcaaccgctgggcttatatgcgtagtttttacggtattgtcgacttactg
tcgattttaccgagttttttagcattgatattcccaggggcaaacgtctcattagcgttc
aggatattaaggctatttagggtatttagagtattaaaattattgcgctacctcagtgaa
ggaaacttgctgctaaaagcgatgattcagtctcgcaggaaagtgtttattttcttcttt
tcagtgagcttgatcataatggcattaagcgtcgtaatgtatgtggttgaaggacctgga
aatgggtttacttcaattccaaaatcgatgtattggaccatagtgactatcacaacagtt
ggttatggcgatatcacgccacagactaatttaggtcaggcgattgcttcacttaccatg
ctaattggttattcaattattgcgattcctacaggaatattaaccgctgaaatatcacat
gaaatggttgctgagcgagatttaagaaagtgcagcaattgtggtactcgtggccataat
ttacaggctttattttgtcatcactgtggtagtgaattagagcaacatcaatcagaaggg
aaatcatga

DBGET integrated database retrieval system