KEGG   Salimicrobium jeotgali: AAV35_001595Help
Entry
AAV35_001595      CDS       T04359                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00010  Glycolysis / Gluconeogenesis
sje00620  Pyruvate metabolism
sje01100  Metabolic pathways
sje01110  Biosynthesis of secondary metabolites
sje01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAV35_001595
   00620 Pyruvate metabolism
    AAV35_001595
Enzymes [BR:sje01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AAV35_001595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKG03604
UniProt: K2FMH7
LinkDB All DBs
Position
complement(309332..310852)
Genome map
AA seq 506 aa AA seqDB search
MVYQNPNTEGSPVQFKEQYENYIGGEWTPPEKGQYFDNVTPVTGKNFTRIPRSTEEDINK
AIEAGHKAQKAWGSTSVAERANILNKIADRMEENLELLAVAETWDNGKAVRETLNADIPL
AIDHFRYFAGAIRAQEGSIGQIDEDTVAYHFNEPLGVVGQIIPWNFPILMATWKLAPALA
TGNCVVLKPAEQTPASILFLMEMIEDLLPAGVLNIVNGFGLETGKPLAQHPDIQKIAFTG
ETTTGRMIMQYASQNIIPVTLELGGKSPNVFFPDIMQEDDDFLDKAVEGLVMFALNQGEV
CTCPSRALVHESIYDEFMERAIKRVKEIKTGNPLDPNTAMGAQASSEQLEKILSYLEIGK
DEGAELLVGGEQNKMDGEFSDGYYVKPTIFKGTNDMRIFQEEIFGPVLSVTTFKDEDEAM
EIANDTLYGLGAGIWTRNVNTAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKMSGIGREN
HKMMLGHYQQTKNMLVSYSPQKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggtatatcaaaacccaaacacagaagggtccccggttcaattcaaagaacagtatgag
aactacatcggaggggaatggacgccgcccgaaaaagggcaatacttcgacaacgtaact
ccggtaaccggcaaaaacttcaccagaatcccccgctctacagaagaagatataaataaa
gccattgaagcaggacataaagctcaaaaagcctggggctccacttccgttgcggaaaga
gccaatatattaaataaaattgccgatcgcatggaggagaaccttgaacttctcgctgtc
gcagaaacctgggacaacggaaaagcggtccgcgaaaccctcaacgcagatataccactt
gccatcgaccacttccgctattttgcaggcgcaattcgtgctcaggaaggctccatcggc
cagattgatgaagacacggtagcctatcatttcaatgagcctctgggtgtcgtcggtcag
atcattccatggaacttccctatcctcatggcgacctggaaactggctcctgccctcgcc
accggcaactgcgtagtactgaagccggcggaacagactcctgcctccatcctttttctg
atggaaatgattgaagatctgcttcctgccggagtattgaatatcgttaacgggttcggt
ctcgagaccgggaaacctcttgcccagcatcctgatattcagaagattgctttcaccggc
gaaacgacgaccggccggatgattatgcagtacgcttcccagaatatcattccggtaaca
ctggaacttggtggaaagtccccgaacgtattcttcccggatattatgcaggaagacgat
gattttctcgacaaagcggtggaaggtctcgtcatgttcgcgctgaaccagggtgaagta
tgtacatgtccgtcacgtgcccttgtgcatgaatccatttacgatgaatttatggagaga
gccattaaacgggtgaaagaaatcaagacagggaatccgcttgatccgaacacagctatg
ggagcgcaagcttcttccgaacaactggaaaaaatactttcgtatcttgaaataggtaaa
gatgaaggtgccgaactgctcgtcggaggagaacagaataaaatggacggggaattttcc
gacggctactacgtgaaaccgacgatattcaaagggacaaacgatatgcgtatattccag
gaggagattttcggccctgtcctgtccgtcactacgttcaaggatgaagatgaagccatg
gaaattgccaatgataccctgtacggtctcggcgccggtatctggacccgcaacgtgaat
acggcctaccgcttcggacgcggcatccaggcgggacgcgtatggacgaactgctaccac
gcctaccctgctcacgctgcctttggcggttacaagatgtccggtatcggccgcgagaac
cacaaaatgatgctcggccactatcagcagacgaaaaacatgctcgtcagctacagcccg
caaaaacttggattcttttaa

DBGET integrated database retrieval system