KEGG   Salimicrobium jeotgali: AAV35_010360Help
Entry
AAV35_010360      CDS       T04359                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00620  Pyruvate metabolism
sje00680  Methane metabolism
sje01100  Metabolic pathways
sje01120  Microbial metabolism in diverse environments
sje01200  Carbon metabolism
Module
sje_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAV35_010360
  09102 Energy metabolism
   00680 Methane metabolism
    AAV35_010360
Enzymes [BR:sje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AAV35_010360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 STAS
Motif
Other DBs
NCBI-ProteinID: AKG05148
LinkDB All DBs
Position
2077732..2080491
Genome map
AA seq 919 aa AA seqDB search
MNTQPTSNNHTTPLRHDIRVLGEMLGKVLVHQGGQELLDKVERIRKLTKDLRSTPDSSTY
ETLKSEITELKPPMRSQVIRAFSIYFHLVNIAEQNHRIRRRREYQLREDMSVQPFSLESA
VQNLKENDYSKDVIQETLDKLSLELIITAHPTEATKRTVLEIQKRIATILKQLDESRLTR
REREGVMDSLQNEVTALWQTEELRERKPTVMDEVRNGLYYFDHTLFDVLPDIHQELEHQL
EVNYPEEEWSVPDFLHFGSWIGGDRDGNPNVTPEVTWETLHKHRNLILKKYEDSLVDLMK
RFSQSLAYVQVSGKLMQSIEREETWLPEDKVWKVEKEVYRRKFAVILERLRQIGQSETGY
RSADEMLNDLSLIQENALRHQPESRELKSLRKLIRQVSLFGFHLATLDVRNHSGEHEIAV
SELLQKVGITDDYSSLSEADKTGILENVLKDPRPLSLLNEDYSEATRQIMNVFHMIRDAH
KEFGKRSIEVYLISMTESVSDLLEVLVLAKEAGIYRLHADGSVESDLDVAPLLETVDDLV
AGPDIIKTLFEMEVFSKHLEKRGNHQEIMLGYSDGSKDGGTLTANWRLYKAQVEIHEMAR
EYNIGLKFFHGRGGSLGRGGGPLHRSLLSQPVETLGDGVKITEQGEVLSSRYMLRDIAYR
SLEQGASTLLEGAANVSKESEQGFHREDSWEEAMEEISDVSLKTYQSLVFGDKDFISYFN
EATPLNELSELNIGSRPMKRKDSSKFENLRAIPWVFAWTQSRQLLPGWFAAGSGLADYRD
RADGNMELLRQMYENWPFFRSTINNLQMALTKADIQTAREYKSLVKDEAVGERIFNTIVD
EYERTKEVLLQITEDDELLDHQPTIQESVRLRNPYVDPMNFLQVELIKELRETKNPGDEL
LKEVLLTISGVAAGLRNTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacacaaccaacatccaacaatcatactacgccactgcgtcatgatatacgggtc
ctaggcgaaatgctcggtaaagtcctcgttcatcagggcggtcaggaattacttgataaa
gtggaaagaatacgcaagttaacaaaggacttgcggagcacccctgattcttcgacttat
gagacattaaagtcggaaatcaccgaattgaaaccgcctatgcgttctcaggtgatccgt
gctttttccatatactttcacctggtgaacatagccgaacagaatcaccgtatacgccgg
cggagagagtaccagctcagagaagacatgtccgtacagccgttttcactggagagtgct
gtgcagaacctaaaagaaaatgattattcaaaagatgtcattcaggagacactggacaaa
ctttctttggagttgatcataacggcccatcctacagaagcgacgaagcggaccgtactg
gaaatacaaaaaaggattgctaccattttgaaacagctggatgaaagcagactcacccgg
agagaaagggaaggcgtcatggacagtcttcagaatgaagtcaccgcactttggcagaca
gaagagctccgggagcggaaaccgaccgttatggatgaagtaaggaacggcctgtactac
tttgaccatacgttgttcgacgtcttaccggatattcaccaggaactagaacatcagctt
gaggtgaactatcccgaagaagaatggtctgtacctgattttcttcatttcggttcctgg
atcggcggagacagggatgggaatccgaacgtgacgccggaagtcacctgggaaaccctg
cataagcacagaaacctgattttaaaaaaatacgaagattcgctcgtcgatctgatgaaa
cgtttcagccagtcgcttgcttacgtccaggtgtccgggaagctcatgcagtctatcgaa
agagaagaaacgtggcttccggaggacaaagtatggaaagtggaaaaagaagtgtaccgc
agaaaattcgcggtgatactagagcgtctgcgtcaaataggtcagtcagaaaccggctac
agaagcgccgatgagatgcttaatgacctgtccctgattcaggaaaacgcgcttcgccat
cagcctgaaagcagagagcttaaaagcctgagaaaacttatccgtcaggtaagtctgttc
ggtttccatctggctactctcgatgtccgtaatcacagtggcgaacatgaaatagctgtc
tcggaacttttacagaaagtagggatcacagacgattattcgtccctgagtgaagcggat
aaaaccgggatccttgagaatgtattgaaagacccgagacctctttctctgttgaatgaa
gactattcggaagcgacccgtcaaattatgaacgttttccatatgatacgtgatgctcat
aaagaattcgggaaacgctccattgaagtctacctgataagtatgacagagtccgtcagt
gatcttctcgaagtcctcgtacttgctaaagaagccgggatttaccgtcttcatgcagac
ggaagtgtcgaaagcgacctcgacgtcgcacctttactcgaaactgtagatgaccttgtt
gccggacctgacatcatcaagaccctgtttgaaatggaagtattttcgaaacacctggaa
aaacggggcaaccaccaggagattatgctcggttattccgacggcagcaaagatggcggc
acgctcacagccaactggagactgtacaaggctcaggtcgagatccatgagatggcccgc
gaatataacatcggtcttaagttcttccacggccgcgggggctctctcggcagaggagga
gggcccctccaccggagtcttctttcccaaccggtagagacacttggagatggcgtgaaa
ataaccgaacagggagaagtcctttcttcccggtacatgctccgtgatatagcttaccgt
agtctcgagcagggggcttctacgctcttggaaggggccgctaacgtttcaaaagagtca
gagcagggttttcatcgggaagacagctgggaagaggcgatggaagagatatccgacgtt
tccttaaagacatatcagtcactcgttttcggagacaaagatttcatttcttatttcaat
gaagctactccgctgaacgaactgagcgaactgaatatcgggtctcgtcccatgaagcgt
aaagacagttcgaaattcgaaaacctgcgtgccattccctgggtattcgcctggacgcaa
agtcgtcagctgctgccggggtggttcgcagccggctccgggctcgctgattaccgggac
cgggccgatgggaatatggaactgcttcgacaaatgtatgaaaactggcctttcttccgc
tccactataaacaatctgcagatggccctcacgaaagcggatattcagactgccagagag
tacaaatcgctcgtgaaagacgaagcggtaggagaacggattttcaatacgattgtagac
gaatatgaaagaacgaaagaagtccttctccagattactgaagacgatgaactgctcgat
catcagccgacaattcaggagtccgtgcgcctccgtaacccgtacgtggaccctatgaat
ttccttcaggtggaactgatcaaggaactccgggaaacgaagaacccgggagatgaactg
ctaaaagaagttctgctcactatcagtggtgtagctgcagggctcagaaacaccggttaa

DBGET integrated database retrieval system