KEGG   Salimicrobium jeotgali: AAV35_010790Help
Entry
AAV35_010790      CDS       T04359                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00010  Glycolysis / Gluconeogenesis
sje00053  Ascorbate and aldarate metabolism
sje00071  Fatty acid degradation
sje00280  Valine, leucine and isoleucine degradation
sje00310  Lysine degradation
sje00330  Arginine and proline metabolism
sje00340  Histidine metabolism
sje00380  Tryptophan metabolism
sje00410  beta-Alanine metabolism
sje00561  Glycerolipid metabolism
sje00620  Pyruvate metabolism
sje00625  Chloroalkane and chloroalkene degradation
sje01100  Metabolic pathways
sje01110  Biosynthesis of secondary metabolites
sje01120  Microbial metabolism in diverse environments
sje01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAV35_010790
   00053 Ascorbate and aldarate metabolism
    AAV35_010790
   00620 Pyruvate metabolism
    AAV35_010790
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAV35_010790
   00561 Glycerolipid metabolism
    AAV35_010790
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAV35_010790
   00310 Lysine degradation
    AAV35_010790
   00330 Arginine and proline metabolism
    AAV35_010790
   00340 Histidine metabolism
    AAV35_010790
   00380 Tryptophan metabolism
    AAV35_010790
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAV35_010790
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AAV35_010790
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAV35_010790
Enzymes [BR:sje01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AAV35_010790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1700
Motif
Other DBs
NCBI-ProteinID: AKG05224
UniProt: K2H9Q8
LinkDB All DBs
Position
complement(2175550..2176977)
Genome map
AA seq 475 aa AA seqDB search
MKRYLKHYINGEWVESTGSETTEVINPATEEAFGEISLGTKEDLDKAVQAARDAFPHFSQ
MPKEERVKMLEDIAEEYNNRKDDIIDTITEELGSPVEVSEKVHFMMGYNHFAQAAESLKS
FSFVEEYEGHTRMKEASGVSGLITPWNFPTNQTSTKIASAFAAGSPVVLKPAEQTPFAAF
ILTEIFDKVGVPKGVFNLVNGTGEVIGDGISSHKDIDFVSFTGSGATGEKIMKNAAENIT
NIALELGGKSPLIVLDDADVKDAARTALTHITNNTGQVCSAATRTLIPSSMKDEFEQAIK
DVLPEFKVGDPHEGNHMGPIVSQKQWDTVQSYMEKGTEEGATLLVGGPGKPEGLEQGYYA
KPTVFTDVDNGMVIAREEIFGPVMCVLTYDSLDEAIEIANDTEYGLAGYVYGKDKEKLRK
ASAGIRAGRVKVNDTKADFAAPFGGYKHSGIGREWGDHGIEEYLEVKTILGYPEK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatatcttaaacattatattaacggggaatgggtggagtccaccggttctgaa
acgactgaagtcatcaaccctgctaccgaagaagcgttcggagagataagtctcggcacg
aaagaggatctggacaaagcagtgcaggctgcacgcgatgcgttccctcacttttcacaa
atgcctaaagaggaaagggtgaaaatgcttgaggacattgccgaagagtacaacaatcgc
aaagacgacattatagacacgattacagaagaactcggttctcccgtcgaagtttccgag
aaagtgcacttcatgatggggtacaaccactttgcccaggcagcggaatcactgaagagt
ttttcgttcgtcgaagaatatgaaggacacacaagaatgaaggaagccagtggtgtcagt
ggtctgatcaccccgtggaacttccctacgaaccagacatcgacgaaaattgccagcgct
tttgctgcaggcagccccgttgtattgaagccggcggaacagacgccttttgcagctttt
atccttacagaaatattcgataaagtgggcgttccaaaaggtgtgttcaacctggtgaat
ggtaccggggaagttatcggggacggtataagttctcataaggatatcgacttcgtttcc
ttcaccgggtcgggagccacgggtgagaagattatgaaaaatgcagcagaaaacattacg
aatatagcgcttgagcttggagggaaatctccattgatcgtgcttgatgacgcagatgtg
aaagatgccgcccgtacggctcttacacacatcacgaataataccggtcaggtatgttca
gcagctacaaggacccttattccttcttcgatgaaggacgaatttgagcaggcgatcaaa
gatgtgctgcctgaatttaaagtaggagacccgcatgaaggaaatcatatgggaccgatc
gtatctcagaagcaatgggacaccgtccagtcctatatggaaaaaggaacagaagaaggg
gccactcttctcgtcggcggcccggggaaacctgaaggtcttgagcagggctactatgcg
aagccgactgtcttcacggatgtggataatggcatggtcatcgcacgtgaagaaatcttc
ggacccgtcatgtgcgttcttacgtacgactccctcgatgaggctatcgaaatcgccaac
gatacggaatacggtcttgccggttacgtgtacgggaaagacaaagagaaattaaggaaa
gcttctgcaggtatacgcgccggccgtgttaaagtcaatgatacgaaagcggactttgct
gcaccattcggcggctataaacactcaggcatcggaagagaatggggagaccatggtatt
gaagaatatctggaagtaaaaaccattctcgggtaccctgaaaaataa

DBGET integrated database retrieval system