KEGG   Salimicrobium jeotgali: AAV35_011055Help
Entry
AAV35_011055      CDS       T04359                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sje  Salimicrobium jeotgali
Brite
KEGG Orthology (KO) [BR:sje00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AAV35_011055
Enzymes [BR:sje01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AAV35_011055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 HI0933_like Thi4 AlaDh_PNT_C FAD_binding_2 DAO FAD_binding_3 NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AKG05267
UniProt: K2GPM4
LinkDB All DBs
Position
2228069..2229631
Genome map
AA seq 520 aa AA seqDB search
MLDKDIKAQLEQYLQLLEGDIVLKVSAGSDDVSKEMLELVDELSTMSSRINVEKTELKRT
PSFSVNRPDEETGITFAGVPLGHEFTSLVMALVQVSGRPPKVEQSVIDRIKAIDEDYHFE
TYVSLSCNNCPVVVQALNIMSVVNPRISHTMIEGGAFKDEVDSKNIMGVPTVFLNNEEWG
GGRMELEEILSALGSGPDSSEFEGKDPFDVLVVGGGPAGGSAAIYAARKGIRTGLLTDRV
GGQVLDTNAIENFISVQETDGPKLSSNLHEHVGGYNVDVMNQVKAANIERKDNHIEVELE
NGAVLQSKTAILSTGARWRNIGVPGEQEFKNKGVAYCPHCDGPMFEGKDIAVIGGGNSGV
EAAIDLAGVVKHVTVLEFSSASKADSVLLDRLHSLPNVTFITNAQTTEITGDETVNGLTY
TDRVSGEERHLELEGVFVQIGLVPNTEWLDDSIERTKTGEIVVDKKGATNVPGIFAAGDC
TDSAYKQIIISMGQGATSALGAFDYLIRNTAPAESEAVTS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctagacaaagatattaaagcacagcttgaacaatatcttcagctgcttgaaggcgac
atcgtcctgaaagtaagtgcaggctcggatgacgtatccaaagagatgctcgagctggtg
gatgaactgtccaccatgtcttcccgcataaacgtagagaagacagagctgaaacgcacg
ccaagtttcagtgtcaatcgtccggatgaagagaccggcatcacattcgccggggttcct
ctcggacacgaattcacgtctctcgtcatggcgctcgttcaggtgagcggtcgtccgccg
aaggttgaacagagcgtgattgatcgcatcaaagcgattgatgaagactatcatttcgaa
acgtacgtcagcttaagctgtaacaactgtcctgtcgtcgttcaggcattgaacatcatg
agcgtggtcaacccgcgtatttcccacaccatgatcgaaggcggcgctttcaaggacgaa
gtcgacagcaaaaacattatgggcgtaccgaccgtcttcctgaacaatgaagaatggggc
ggcggccgcatggagctggaagagattctctctgctctcggaagcggtcccgactcctct
gaattcgaagggaaagacccgtttgatgttcttgtcgtaggcggaggcccggccggcgga
agtgccgctatctatgctgcacgtaaaggcatccgtacaggactgcttaccgaccgtgtc
ggcggccaggttctcgatacgaacgctatcgaaaactttatcagcgtccaggaaacagac
ggaccgaagctttcctccaatcttcacgaacacgtcggaggttacaatgtggacgtgatg
aatcaggtaaaagctgcgaatatcgaacgtaaagataaccacatcgaagtggagctggaa
aacggagctgttctgcaaagtaaaacagccattctctccacaggcgcccgctggcgtaat
atcggcgttcccggcgaacaggaattcaagaacaaaggagtagcctattgcccgcactgt
gacggaccgatgttcgaaggaaaagacattgcggtcatcggcggcggcaactccggtgtg
gaggcagccatcgaccttgcaggcgtggttaaacacgtcacagtccttgagttctcttcc
gcatcgaaagcggactccgtactgctggatcgtcttcacagtcttccgaacgtaacgttt
attacaaacgcacagacgacggaaattacaggagacgagacagtgaacggcctgacttac
acagaccgcgtaagcggggaagaacgccacttggaactcgaaggtgtcttcgtccagatc
ggtctcgtaccgaacactgaatggctcgatgattccattgagcgtacgaaaaccggtgaa
atcgtagtcgataaaaaaggtgcaacaaacgtacccggaatttttgcggcaggcgactgt
acagacagtgcctataagcagatcatcatttccatgggtcagggtgcaacatctgccctc
ggtgctttcgactatctgattcgcaacacggctcctgccgaaagcgaagcagtcacttca
taa

DBGET integrated database retrieval system