KEGG   Sphingobium japonicum: SJA_C1-03080Help
Entry
SJA_C1-03080      CDS       T01201                                 

Definition
(GenBank) ABC-type transport system ATPase component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
sjp  Sphingobium japonicum
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sjp02000]
    SJA_C1-03080
Transporters [BR:sjp02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    SJA_C1-03080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_16 SbcCD_C T2SSE AAA_29 AAA_24 cobW AAA_22 SMC_N AAA_27
Motif
Other DBs
NCBI-ProteinID: BAI95142
NITE: SJA_C1-03080
UniProt: D4YXR0
LinkDB All DBs
Position
1:complement(324467..325423)
Genome map
AA seq 318 aa AA seqDB search
MIGASQPTYAVEGRGLVKTFGDFRAVDGIDVAVPAGSIYGILGPNGAGKTTMLRTLLGII
DPDEGHRSLLGDPAPLRQARNVGYLPEERGLYPSMKAFEAVAFMGALRGLPLRIGRERAR
AMLADYGMGASAEKPIRQLSKGMAQTVQLFGTIVHEPRLIVLDEPFSGLDAFNQGKLEVL
IRDQARRGVTVLFSTHVIAHAERLCERVAIVAGGRVRFEGTVDDARNRLRPQVRLRTRAS
DGGWRRALPAETLAEDGTWHFPLPQEGIEPLLRALLDGNAGIESLSIERPGLHDAFVAIA
GEAAARQMQDDQQREEAA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatcggggcttctcaaccgacctatgccgtcgaaggccgtggtcttgtcaagacattc
ggcgatttccgggcagtggacggcatcgacgtcgcggtgcccgccgggtcgatctacggc
attctcggccccaatggcgcgggcaagacgacgatgctgcgcacgctgctgggcatcatc
gatcccgatgaggggcaccgcagcctgctgggcgaccccgcgccgctgcgccaggcgcgc
aatgtcggctatctgccggaggaacgcggcctctacccgtcgatgaaggcgtttgaggcc
gtcgccttcatgggcgcgctgcgcggcctgccgctcaggatcgggcgggaacgcgcccgc
gccatgctggcggactacggcatgggcgcctccgccgaaaagccgatccgccaattgtcg
aagggcatggcccagacagtccagcttttcggcaccatcgtccacgaaccgcgcctgatc
gtgctggacgagcccttttccggcctggacgccttcaaccagggcaagctggaggtgctg
atccgggaccaggcccggcgcggcgtcacggtgctgttctccacccatgtgatcgcccat
gccgaacggctgtgcgagcgcgtcgccatcgtcgcgggcggccgcgtccgcttcgaaggc
acggtggacgacgcccgcaaccggctgcgcccgcaggtgcgcctgcgcacccgcgccagc
gacggcggctggcgccgcgccttgcccgccgaaacgctggcggaggacggaacctggcat
ttccccctgccgcaggagggcattgagccgctgcttcgcgccctgctggacggcaatgcc
gggatagaaagcctctcgatcgagcgccccggcctgcacgacgccttcgtcgccatagcg
ggcgaggcggccgcccggcagatgcaggacgaccagcagcgggaggaagcggcatga

DBGET integrated database retrieval system