KEGG   Sphingobium japonicum: SJA_C1-12450Help
Entry
SJA_C1-12450      CDS       T01201                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SJA_C1-12450 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sjp02000]
    SJA_C1-12450 (gst)
Enzymes [BR:sjp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SJA_C1-12450 (gst)
Transporters [BR:sjp02000]
 Other Transporters
  Pores ion channels [TC:1]
   SJA_C1-12450 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAI96079
NITE: SJA_C1-12450
UniProt: D4Z0E7
LinkDB All DBs
Position
1:complement(1230666..1231295)
Genome map
AA seq 209 aa AA seqDB search
MAETITLYTNPMSRGQIARWMLEEVGQPYEMVVLDYGEGGMKSADYLAINPMGKVPAIVH
DGRTITECAAICAYLADAFPAANLAPPTDRRADYYRWLFFAAGPVEAAVTNKALGFVVPE
GRERTAGYGTFDTMVDTLEHAVSGPGWICGDQFTAADVYVGSQIDWGLAFGTIPSRPVFE
AYVARLRERPAYKRQKEMDNALIAQMQKP
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccatcaccctctacaccaacccgatgtcgcggggacagatcgcccgctgg
atgctggaggaggtcggccaaccctatgagatggtcgtgctggattatggcgaaggcggc
atgaaatccgccgattatctggcgatcaatccgatgggcaaggttcccgccatcgtccat
gacggcaggacgatcacggaatgcgcggcgatctgcgcctatctggcagacgcctttccc
gccgcgaacctcgcgccgccgacggacaggcgcgccgactattatcgctggctgtttttc
gccgccggcccggtggaagcggccgtcaccaacaaggcgctcggcttcgtcgttcccgaa
ggccgggaacgaacggcgggctacggcacgttcgacaccatggtcgacacgctggaacat
gccgtctcaggccccggctggatttgcggcgaccagttcaccgccgccgacgtctatgtc
ggttcgcagatcgactggggcctggccttcggcacgatccccagccgccccgtcttcgaa
gcctatgtcgcccgcctgcgcgaacgcccggcctataaacggcagaaggagatggacaac
gccctcatcgcccagatgcaaaaaccttaa

DBGET integrated database retrieval system