KEGG   Sphingobium japonicum: SJA_C1-24030Help
Entry
SJA_C1-24030      CDS       T01201                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01130  Biosynthesis of antibiotics
sjp01230  Biosynthesis of amino acids
Module
sjp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SJA_C1-24030 (aroK)
Enzymes [BR:sjp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SJA_C1-24030 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 AAA_22 dNK CoaE AAA_17 AAA_16 AAA_5 AAA MMR_HSR1 Cytidylate_kin RsgA_GTPase TsaE
Motif
Other DBs
NCBI-ProteinID: BAI97237
NITE: SJA_C1-24030
UniProt: D4Z3Q5
LinkDB All DBs
Position
1:2421008..2421556
Genome map
AA seq 182 aa AA seqDB search
MQRNSKSADARAKRGPIVLVGMMGVGKSTVGRRLAARLDVDFVDADEEIEKAAGMTISEM
FERYGEAYFRDGERRVIARLMDGEPKVIATGGGAFMQEETRALILDHALAIWLNADIDTL
VDRVSRREGRPLLKGKDPRAVLTELAAIRNPVYALCPIHVKSAAAPHDVAVDSIMEQLSQ
WP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaaacagcaaatccgccgatgcgcgagcgaagcgcggccccatcgtcctggtg
ggcatgatgggcgtgggcaaatcgaccgttggacggcggctggcggcgcggctggacgtg
gatttcgtcgatgcggacgaggagatcgaaaaagccgcgggcatgacgatcagcgagatg
ttcgagcgctatggcgaggcctatttccgcgacggcgaacggcgcgtgatcgcccggctg
atggacggcgagcccaaggtcatcgccaccggcggcggcgccttcatgcaggaggagacg
cgggcgctgatcctggatcatgcgctggcgatctggctgaacgccgacatcgacacgcta
gtcgaccgggtgtcgcgccgcgaggggcgaccgctgctgaagggcaaggatccgcgcgcc
gtgctgaccgaactggcggcgatccgcaacccggtctacgcgctctgccccattcacgtg
aaaagcgctgccgcgccgcatgacgtcgcggtcgacagcatcatggagcagctttcccaa
tggccatag

DBGET integrated database retrieval system