KEGG   Sphingobium japonicum: SJA_C1-27410Help
Entry
SJA_C1-27410      CDS       T01201                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sjp  Sphingobium japonicum
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SJA_C1-27410 (ahpF)
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SJA_C1-27410 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 AlaDh_PNT_C NAD_binding_7 NAD_binding_8 DAO Glutaredoxin FMO-like K_oxygenase Thi4
Motif
Other DBs
NCBI-ProteinID: BAI97575
NITE: SJA_C1-27410
UniProt: D4Z4P3
LinkDB All DBs
Position
1:2745592..2747172
Genome map
AA seq 526 aa AA seqDB search
MLDANLKGQLKAYMANITQPIELVASLDDGAKSRELKTLLEEIAELSDKVSIATGSDRRV
PSFMIRRAGTDIGVTFAGLPMGHEFTSLVLALLQVGGHPSKAAQDLIQQIKDIDGDFAFE
TYFSLSCQNCPDVVQALNLMAVLNPRIRHTAIDGALFQEEVDARKVMAVPTVFLNGEPFA
SGRMELEQIVAKIDSGAAARAAAKIKAQDPFEVLIVGGGPAGAAAAIYAARKGIRTGIAA
ERFGGQVLDTMDIENFVSVSRTEGPKFAAALEAHVKDYDVEIMNLQKAAKLIPARTEGGY
HEVVLENGASLKGRTVILSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEYDSQLRADAVLQRKLASLPNVKIVTSALTTRVDGNGE
RVTGLSYKDRNSGTEHDVELEGIFVQIGLVPNTEWLKDSIALSPRGEIEIDARGETSLPG
IFAAGDCTTVPYKQIVIACGAGSTAALSAFDYLIRLPATEETAEAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctcaagggtcagctcaaggcctatatggcgaacatcacccagccc
atcgaactggtcgcatcgctggacgacggcgcgaagagccgcgaactcaagaccctgctg
gaagagatcgccgaactgtcggacaaggtgtccatcgccacaggcagcgacaggcgcgtc
cccagcttcatgatccgccgcgccggaacggacatcggcgtcaccttcgcgggcctcccc
atgggccatgaattcaccagccttgtcctcgccctgctccaggtcggcggccatccgtcg
aaggcggcgcaggacctgatccagcagatcaaggatatcgacggcgacttcgccttcgaa
acctatttctcgctctcctgccagaactgccccgacgtggtgcaggcgctgaacctgatg
gcggtcctcaacccccgcatccgccacaccgccatcgacggcgcgctgttccaggaggaa
gtcgacgcccgcaaggtcatggccgtccccaccgtcttcctgaacggcgaacccttcgcc
agcggccgcatggaactggagcagatcgtcgcgaagatcgacagcggcgcggcagcgcgc
gccgccgcgaagatcaaagcccaagacccgttcgaggtgctgatcgtcggcggcggccct
gcgggcgcggcggcggccatctacgcggcgcgcaagggcatacgcaccggcatcgcggcg
gaacgcttcggcggccaggtgctcgacaccatggacatagagaatttcgtctcggtcagc
cgcaccgaaggccccaaattcgccgccgcgctggaggcgcacgtcaaggattatgatgtc
gagatcatgaacctgcaaaaggctgcgaagctgatcccggccaggaccgaaggcggctat
catgaagtcgtgctggaaaatggcgcctcgctgaaaggccgcaccgtcatcctctccacc
ggcgcccgctggcggcagatgggcgtccccggcgaggaggaatatcgcaacaagggcgtc
gcctactgcccacattgcgacggccccctcttcaagggcaagcgcgtggcggtgatcggc
ggcggcaacagcggcgtggaggcggccatcgacctggccggcattgtcgcccatgtgacg
ctgatcgaatatgacagccaactgcgcgccgacgccgtgctccagcgcaagctcgccagc
ctgccgaacgtgaagatcgtcacctccgccctcaccacccgggtggacggcaatggcgag
cgcgtcaccggcctcagctacaaggaccgcaacagcggcacggaacatgatgtcgagctg
gagggcattttcgtccagatcggccttgtccccaacaccgaatggctgaaggacagcatc
gccctctccccccgcggcgagatagagatcgacgcgcgcggcgaaaccagcctgccgggc
atcttcgcggcgggcgactgcacgaccgtgccctacaagcagatcgtgatcgcctgcggc
gcgggatcgacggcggcgctctccgccttcgactatctcatccgcctccccgcaacggag
gaaaccgccgaagcggcctga

DBGET integrated database retrieval system