KEGG   Sphingobium japonicum: SJA_C1-33580Help
Entry
SJA_C1-33580      CDS       T01201                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00620  Pyruvate metabolism
sjp00680  Methane metabolism
sjp01100  Metabolic pathways
sjp01120  Microbial metabolism in diverse environments
sjp01200  Carbon metabolism
Module
sjp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SJA_C1-33580 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SJA_C1-33580 (ppc)
Enzymes [BR:sjp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SJA_C1-33580 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase ACT_5
Motif
Other DBs
NCBI-ProteinID: BAI98192
NITE: SJA_C1-33580
UniProt: D4Z6G0
LinkDB All DBs
Position
1:complement(3339686..3342403)
Genome map
AA seq 905 aa AA seqDB search
MQHRSIMATLASSSVPAITQNPDIRYLGRLLGDVIRAYGGEKIYKQTEYIRSASVDRARG
LHGADVVDTGLDALNLDDTLSFVRGFMLFSMLANLAEDRQGVAAEPGADVASAVEKLQSH
GIGRQAVLDLLSHALIVPVLTAHPTEVRRKSMIDHKNRIADLMLLKDGGRTETDEGENLD
EAIFRQIALLWQTRPLRREKLFVADEIENVLAYFRDVFLPVLPALYARWERVLGARPQSF
LRVGNWIGGDRDGNPFVQAPQLRLALAKGCEAALGFYMDALHALGAELSLSTELAHVPQA
VLDLADASGDVSPSRQDEPYRRAISGIYARLAATHRSLVGKAAPRPSALKGEPYASPADL
RRDLVTVAQGLASEGNGALATGGALGRLIRAVETFGFHLATLDMRQNSDVHQDVVAELLK
VAGVEADYAGLDEYARIALLRRELANNRPLGTPFFEYSERTASELAIVHAAAEAHRIYGP
QCITHYIISKAESVSDLLEVNIILKEAGLWRAGADGAPPQAAIMAVPLFETIADLEAAPK
IMAAYFGLPEVGGVVRERGHQEVMIGYSDSNKDGGYITSTWGLFQASKALAPVFAEAGTA
MQLFHGRGGAVGRGGGSSFAAIQAQPKGTVQGRIRITEQGEVIAAKFGTRDVAMTNLEAT
TSATLLASLEPEVLSDRDAARFAAAMDQLSKTAFAAYRDLVYGTDGFKEFFRQLTPIQEI
SGLKIGSRPASRTKSTRIEDLRAIPWVFSWAQARVMLPGWYGVGHALSAFEDKALLADMA
QHWSFLQSALANLEMVLAKSDLGIAAHYLPLVEDQARGAEIFDRIRGGWDMTHDGLLAAT
GQSRLLERNPKLDTSIRLRLPYIEPLNLLQVELMKRHRSGEDDPRIKEGIELSINAIATA
LRNSG
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcatcgatccatcatggcgactcttgcatcctcctccgtgccggcgatcacccag
aatcccgacatccgctatctcggccggctgctgggcgacgtcatccgcgcctatggcggg
gagaagatctacaagcagaccgaatatatccgctccgcctccgtcgaccgggcgcggggc
ctgcatggcgcggacgtggtcgacaccggcctggatgcgctgaacctcgacgacacgctc
agcttcgtgcgcggcttcatgctgttctcgatgctcgccaacctggccgaggatcgccag
ggcgtcgccgccgagccgggcgcggacgtcgcctccgccgtcgaaaagctgcaatcccat
ggaataggacgccaggccgtgctcgacctgctgtcccacgccctgatcgtcccggtgctg
accgcccacccgaccgaggtgcggcgcaagagcatgatcgaccacaagaaccgcatcgcc
gacctgatgctgctcaaggatggcggccggacggaaaccgatgagggggagaatctggac
gaggcgatattccgccagatcgcgctgctgtggcagacgcgaccgctgcgccgggaaaag
ctgttcgtcgcggacgagatcgaaaatgtcctcgcctatttccgcgacgtcttcctgccc
gttctgcccgcgctttatgcccgctgggaacgggtgctgggcgcgcgcccgcagagcttc
ctgcgcgtaggcaactggatcggcggggaccgcgacggcaatcccttcgtccaggcgccg
cagcttcgattggcgctcgccaaaggctgcgaggcggcgttgggcttttatatggatgcg
ctccacgccctgggcgcggaactgtcgctctcgaccgaactggcccatgtgccgcaggcg
gtgctggacctggccgacgccagcggcgacgtctcccccagccgccaggacgaaccctat
cgccgggcgatttccggcatatacgcccgtctggccgcaacccacaggtcgctggtgggc
aaggccgcgccccgcccctcggcgctcaagggggaaccctatgccagcccggccgacctg
cggcgcgatctggtgacggtggcgcagggtctggcgagcgagggcaatggcgccctggcg
acgggcggcgcgcttggccgtctgatccgcgcggtcgagaccttcggcttccatctcgcc
acgctcgacatgcggcagaacagcgacgtccaccaggacgtggtggccgaactgctgaaa
gtcgccggcgtcgaggcggactatgccggcctcgacgaatatgcccgcatcgccctgctg
cggcgggaattggcgaacaaccggccgctcggcacgccctttttcgaatattcggaaagg
accgcctccgaactcgccatcgtccatgccgcggcggaggcgcaccgcatctacggcccg
caatgcatcacccattatatcatctccaaggcggaaagcgtttccgacctgctggaggtc
aacatcatcctcaaggaagcgggcctgtggcgcgcgggcgcggacggcgcgccgccgcag
gccgcgatcatggccgtgccgttgttcgaaaccatcgccgacctggaggccgcgcccaag
atcatggccgcctatttcggcctgccggaggtagggggcgtggtgcgggaacgcggccat
caggaagtgatgatcggctattccgacagcaacaaggacggcggctacatcacctccacc
tgggggctgttccaggcgagcaaggcgctggccccggtctttgccgaagcgggcacggcg
atgcagcttttccacggccgcggcggcgcggtcgggcgcggcggcggctcctccttcgcg
gcgatccaggcgcagcccaagggcacggtgcagggccgcatccgcatcaccgaacagggc
gaggtgatcgcggccaaattcggcacccgcgacgtcgccatgaccaatttggaggcgacg
accagcgcgaccctgctcgccagcctggaacccgaagtcctgtccgaccgcgacgccgcc
cgcttcgccgccgccatggaccaattgtcgaagaccgccttcgccgcctatcgcgacctg
gtctacggcaccgacgggttcaaggaattcttccggcaattgaccccgatccaggaaatt
tccggcctcaagatcggctcccgtccggccagccgcaccaagagcacccggatcgaggat
ctgcgcgccatcccctgggtgttcagttgggcgcaggcgcgggtgatgctgccgggctgg
tacggcgtgggtcacgcgctttccgccttcgaggacaaggcattgttggcggacatggcg
cagcactggtccttcctgcaatccgcgctcgccaatctggagatggtgctggccaagtcg
gacctcggcatcgccgcccattatctgccgctggtggaggatcaggcgaggggcgcggag
attttcgaccgcataagaggcggctgggacatgacccatgacggcctgctcgccgccacc
ggccaatcgcgcctgctggagaggaatccgaagctcgacacgtcgatccgcctgcgcctg
ccctatatcgagccgctgaacctgctccaggtcgaactgatgaagcgccaccgcagcggc
gaggacgacccgcgcatcaaggaaggcatagaattgtcgatcaacgcgatcgcgacggcg
ctgaggaatagcggatag

DBGET integrated database retrieval system