KEGG   Streptomyces kanamyceticus: CP970_06995
Entry
CP970_06995       CDS       T06849                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
ska  Streptomyces kanamyceticus
Pathway
ska00997  Biosynthesis of various secondary metabolites - part 3
ska01100  Metabolic pathways
ska01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    CP970_06995
Enzymes [BR:ska01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     CP970_06995
SSDB
Motif
Pfam: DeoC NMO
Other DBs
NCBI-ProteinID: QEU90693
UniProt: A0A5J6G6S4
LinkDB
Position
complement(1789881..1790672)
AA seq 263 aa
MSRLSRRADERYLFIPLDHSVSDGPVADAVEFDRLLGRIVAGGADAVIVHKGRAPSIDPR
HLRSCALIVHLSAGTVHAADEHAKVLVGGVEDAVRLGADAVSVHVNVGSETEAAQLADLG
RIATECQHWNLPLLAMIYPRGPRIADACDPALLSHVVNIAVDLGADLVKTSAAAPLHRMA
EVVASCPVPVLVAGGPENGADLSGYARAVLDAGCAGLAVGRRVFTSADPERLVRELAETV
HAPRDLAGLPRPVPELYDTVATV
NT seq 792 nt   +upstreamnt  +downstreamnt
atgagcaggctctcgcgaagagccgacgaacgctatctgttcattccgctggaccactcc
gtctccgacggccccgtcgccgacgccgtcgagttcgaccggctcctgggccggatcgtg
gcgggcggcgcggacgccgtgatcgtgcacaagggccgcgcgcccagcatcgacccgcgc
cacctgcgctcctgcgcgctgatcgtgcacctcagcgcgggcacggtgcacgccgccgac
gagcatgccaaggtgctcgtcggtggcgtggaggacgccgtgcggctcggcgccgacgcg
gtcagcgtgcacgtcaacgtgggctcggagaccgaggcggcgcagctcgccgacctcggc
cgcatcgccaccgagtgccagcactggaacctgccgctgctcgcgatgatctaccccagg
ggtcccaggatcgccgacgcgtgcgaccccgccctgctctcccacgtggtgaacatcgcc
gtcgacctgggcgccgacctggtcaagacctcggccgccgcgccgctgcaccggatggcg
gaggtcgtggcgagctgcccggtccccgtcctggtggcgggcggacccgagaacggcgcg
gacctgagcggctacgcgcgggccgtgctcgacgccggatgcgccggactcgccgtcggg
cggcgggtgttcaccagcgcggaccccgagcggctggtacgcgaactcgccgagaccgtc
cacgcgccgcgcgacctcgcgggcctgccgcggcccgtccccgagctgtacgacacggtc
gccacggtctga

DBGET integrated database retrieval system