KEGG   Streptomyces kanamyceticus: CP970_20650
Entry
CP970_20650       CDS       T06849                                 

Definition
(GenBank) alkaline phosphatase
  KO
K04342  streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
ska  Streptomyces kanamyceticus
Pathway
ska00521  Streptomycin biosynthesis
ska01100  Metabolic pathways
ska01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CP970_20650
Enzymes [BR:ska01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     CP970_20650
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme DUF2749
Other DBs
NCBI-ProteinID: QEU93001
UniProt: A0A5J6GG75
LinkDB
Position
4865400..4866803
AA seq 467 aa
MARPRLSRSRRRLIVASSVVAATAVAVTVTASAGASDTKDQARRAIQGGKAKNVILLIGD
GMGDSEITLARDYTVGANGRLNMDKFPLTGAYTTYAVHKDGSPDYVTDSAASGSGWATGV
KTVNGRISKTPDTDKAVPTILELAQKKGYATGSVTTAELTDATPAVLASHATDRSCQGPA
DMAKCPADTIAKGGPGSIAEQSVNHKVDVLLGGGKQRFDQKVTDGKYKGLTVTEQAKKLG
YQIVTNDRELKKVKSVKGGKPVLGLFAPGNVPVEWTGKAAAKGGTDPQRCTTSNPGRPAG
TPALDDQATKAIKLLEAKQKSGKGGKHGKGGQGFFLQVEGASIDKQDHAADPCGQIGETA
AFDRAVKVARDYAAKHPDTLVVTTADHAHTSQIVPLEAQPPGLSSTLVTDEGQQLKVNYS
TNTPGQSQEHTGTQVRIAAQGPQAYRVLGVTNQTDLFTTVREALRLR
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggccagaccgcgtctgtcccgttcgcgtcgtcgactgatcgttgcctcgtccgtggtc
gccgccaccgccgtggccgtcaccgtcaccgccagtgcgggggcgtccgacaccaaggac
caggcccgtcgggcgatccagggtggcaaggccaagaacgtcatcctgctcatcggtgac
ggcatgggtgactccgagatcaccctcgcccgggactacacggtgggtgccaacgggcgc
ctcaacatggacaagttcccgctgaccggcgcctacacgacgtacgccgtgcacaaggac
ggctcccccgactacgtcaccgactccgccgccagtggttccggctgggccaccggggtg
aagaccgtgaacgggcggatatccaagacgcccgacaccgacaaggccgtgcccacgatc
ctggagctcgcgcagaagaaggggtacgcgaccgggtccgtcaccaccgccgagctcacc
gacgccaccccggccgtcctcgcgtcgcacgccaccgaccgcagctgccagggtccggcc
gacatggccaagtgccccgcggacaccatcgccaagggcggccccggctccatcgcggag
cagagcgtcaaccacaaggtcgacgtcctcctcggcggcggcaagcagcgcttcgaccag
aaggtcaccgacggcaagtacaagggcctcacggtgaccgagcaggcgaagaagctcggg
tatcaaatcgtcaccaatgaccgtgagttgaaaaaggtcaagtccgtcaagggcggtaag
cccgtgctcgggctcttcgcgcccggcaacgtgcccgtcgagtggaccggcaaggccgcc
gccaagggcgggaccgacccgcagcgctgcaccacctccaaccccggtcgtcccgcgggc
acccccgccctcgacgaccaggccaccaaggccatcaagctcctcgaggccaagcagaag
agcgggaagggtgggaagcacgggaagggcgggcaagggttcttcctgcaggtcgaaggt
gcctccatcgacaagcaggaccacgccgccgacccctgcggccagatcggtgagaccgcc
gcgttcgaccgcgccgtgaaggtcgcgcgcgactacgccgccaagcacccggacaccctg
gtcgtcaccaccgccgaccacgcccacaccagccagatcgtgccccttgaggcgcagccg
cccggcctctcctccacgctcgtcaccgacgagggccagcagctgaaggtcaactactcg
accaacacgcccggtcagtcccaggagcacaccggcacgcaggtgcggatcgcggcgcag
ggcccgcaggcgtaccgcgttctcggcgtcaccaaccagaccgacctcttcaccaccgtg
cgtgaggcgctccgccttcgctga

DBGET integrated database retrieval system