KEGG   Streptomyces kanamyceticus: CP970_43090
Entry
CP970_43090       CDS       T06849                                 

Definition
(GenBank) asparagine synthetase B
  KO
K12674  (carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Organism
ska  Streptomyces kanamyceticus
Pathway
ska00331  Clavulanic acid biosynthesis
ska01100  Metabolic pathways
ska01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    CP970_43090
Enzymes [BR:ska01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.4  (carboxyethyl)arginine beta-lactam-synthase
     CP970_43090
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC
Other DBs
NCBI-ProteinID: QEU96830
UniProt: A0A5J6GLN8
LinkDB
Position
complement(9933265..9934821)
AA seq 518 aa
MTPNSPAAIGFRTELRQDGGHLTEPVFAARGSRATWQERAADLTLHAVLLHSGAPDEACA
RARGRTLVFAGELYNRDALHRLLPPGRALPGTDAALVSALFDVYDLHVFRLLNGRFAALV
TESGRALLATDHVGSVPLYVRVAPGRVLAATEAKALRDAPPGRPVPARPVRRKTGTHQVP
AGTVLDIEVATGKCVPHRTWAPPLARRILPEEEATDTVRRAVERAVRTRAGGSTPLVVLS
GGIDSSAVAALAARRSAKPIDTVSMGTDAADEFPQARVVARHIGSAHREITVPIAELLRW
LPHTVWAAECLDPDIVEYLLPLTALYLRIGGPGRRVLTGYGADIPLGGMHRENRLPRLDT
AVCHDMDTFDGLNEMSPTLSAVGGHWTTHPYWDRDVLDVLVSLEAGLKRRHGQDKWVLRA
AMSDVLPHEVVVRPKLGVHEGSGTSASFSRLLVDAGAPRERVREAKRLVVREVFDQVVVG
GRHPDDVAIDSVVDAVLGAGVEPATARLSGAAARPVPR
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgacaccgaactcccccgccgccatcggcttccgcaccgaactccgccaggacggcggg
cacttgaccgaaccggtcttcgcggcacgcggctcgcgggcgacgtggcaggaacgcgcg
gccgacctgaccctgcacgccgtactcctgcactccggagcgccggacgaggcctgcgcc
cgtgcccggggcaggacgctggtcttcgccggagagctgtacaaccgggacgcgttgcac
cggctgctgccgccggggcgcgcgctgccgggcaccgacgccgctctcgtcagcgccctc
ttcgacgtctacgacctccacgtcttccggctcctgaacggacggttcgccgccctggtg
acggagtccgggcgggccctgctcgccacggaccacgtcggctcggtgccgctgtacgtc
cgcgtcgccccggggcgcgtcctcgcggcgacggaggccaaagcgctgcgggacgccccg
ccggggcgtcccgtccccgcccgcccggtacgccgaaagaccggcacccaccaggttccg
gcgggcacggtcctcgacatcgaggtggccaccgggaagtgcgtcccgcaccgcacgtgg
gcgccgccgctcgcccgccggatcctgccggaggaggaggcgaccgacaccgtgcgcagg
gcggtggagcgcgcggtgcggacccgcgcgggagggagcacgcccctggtggtgctctcg
ggaggcatcgactcctcggccgtcgcggcgctggccgcccggcggtcggccaagcccatc
gacaccgtgtcgatgggcaccgacgcggccgacgagttcccgcaggcgcgcgtcgtggcc
cggcacatcggctccgcgcaccgggagatcaccgtcccgatcgccgaacttctgcggtgg
cttccgcacaccgtctgggccgccgaatgcctcgacccggacatcgtcgaatacctgctg
ccgctgaccgccctgtacctgcgcatcggcggcccggggcggcgcgtcctcaccggctac
ggggccgacatcccgctcggcggcatgcaccgggagaaccggctgccgcgcctcgacacg
gccgtctgccacgacatggataccttcgacggcctcaacgagatgtcgccgacgctctcc
gcggtgggcggccactggacgacccacccctactgggaccgcgacgtcctcgacgtcctg
gtgtccctcgaggcagggctcaagcgccgtcacgggcaggacaagtgggtgctgcgcgcc
gccatgagcgacgtcctgccgcacgaggtcgtcgtccgccccaagctcggcgtgcacgag
ggatcgggcaccagcgcgtccttctcccggctcctggtggacgccggtgcccctcgggag
cgcgtgcgcgaggccaagcgcctggtggtccgggaggtcttcgatcaagtcgtggtcggc
ggacggcatccggacgacgtggcgatcgactcggtggtcgacgccgtgctcggcgcgggg
gtcgagcccgccaccgcccggctgtccggcgccgccgcccgtcccgttccgcgatga

DBGET integrated database retrieval system