KEGG   Sanguibacter keddieii: Sked_03930Help
Entry
Sked_03930        CDS       T01214                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ske  Sanguibacter keddieii
Pathway
ske00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ske00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Sked_03930
Enzymes [BR:ske01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sked_03930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Glyco_hydro_35 DUF4350
Motif
Other DBs
NCBI-ProteinID: ACZ20360
UniProt: D1BK83
LinkDB All DBs
Position
438025..440073
Genome map
AA seq 682 aa AA seqDB search
MSESTAVRTAAADAGWLPGVGTISYGGDYNPEQWPEEVWVEDVALMREAGVNLVSVGIFS
WARLEPQEGVFDFAWLDRLFDLLHDAGIRVDLGTPTAAPPAWFYATYPDSRVVTRDGVVL
GHGSRGMVSPSSPDYRRACERITRALGERYGAHPALALWHVHNEYGAPVSDSYDDHSVRA
FRTWLQARYGTLDGLNTAWGTAFWGQTYGEWDHIGAPATSASVVNPAQRLDFARFTSDAL
LACFTAERDILHELSPGIPVTTNFMATSCPSMDLWRWAREVDVVSNDHYLTAAEVRNHVT
LALDADLTRSLAGGKPWILMEHSTSGVNWQPRNVAKRRGEMARNALSHLGRGADGILFFQ
WRASRSGAEKFHSSMLPHAGTSSRVWKEVVELGGMLSNLAEVKGSRVHADVAILWDWESF
WAQDLEWRPSVDHSHRERIVAFYDQLWRDNVTADLVHPEADLSGYRMVLAPASYLLTDAG
AANLTAFTAAGGTLVVSCFSGLVDENDAVRAGGLVAALHDVLGVRVDELLPLREGETLAL
SGGRFDGLEADVWSEDLVVTTADVAATYASGPAEGEAAITRNVHGDGVAWYTSTRLTGAA
LTAFLDGAYADARLVPERSLPEGVEVVRRRSTDGRSEYTVVLNHGTEDVLVPGAGRVIVG
DEVDGTPRVPAGGVAVAVSEIG
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtccaccgccgtccgcaccgcagcagccgatgcaggctggctccccggtgtc
gggaccatcagctacggcggggactacaaccccgagcagtggcccgaggaggtctgggtc
gaggacgtcgccctgatgcgcgaggccggcgtgaacctcgtgagcgtcggcatcttctcg
tgggcgcggctcgagccgcaggagggcgtcttcgacttcgcgtggctcgaccggctcttc
gacctgctccacgacgccggcatccgcgtcgacctcggcacgccgaccgcagccccgccg
gcctggttctacgccacctaccccgactcccgcgtggtcacccgcgacggcgtggtcctc
gggcacgggtcgcgcggcatggtcagtccgtcctcgcccgactaccgccgcgcctgcgag
cgcatcacccgtgcgctcggcgagcgctacggcgcgcaccccgcgctcgcgctctggcac
gtgcacaacgagtacggcgcacccgtctcggacagctacgacgaccactcggtccgcgcc
ttccgcacctggctccaggcgcgctacggcacgctcgacgggctcaacaccgcgtggggc
acggccttctggggccagacctacggcgagtgggaccacatcggtgcgccggccacctcg
gcgagcgtggtgaaccccgcgcagcgcctcgacttcgcccgcttcacctcggacgcgctg
ctcgcctgcttcacggccgagcgcgacatcctgcacgagctctcgccggggatcccggtg
acgaccaacttcatggcgaccagctgcccgtcgatggacctgtggcgctgggcccgcgag
gtcgacgtggtgagcaacgaccactacctgacggccgccgaggtccggaaccacgtgacg
ctggcgctcgacgccgacctcacccgctcgctcgcgggcggcaagccgtggatcctcatg
gagcactccacgtcgggggtcaactggcagccgcgcaacgtcgccaagcgccgcggcgag
atggcgcgcaacgccctctcgcacctcggtcgcggtgccgacggcatcctgttcttccag
tggcgcgcctcgcgctccggcgcggagaagttccactcctcgatgctcccgcacgccggg
acgtcgagccgggtgtggaaggaggtcgtcgagctcggcggcatgctctcgaacctggcc
gaggtcaagggctcgcgcgtgcacgccgacgtcgcgatcctctgggactgggagtccttc
tgggcccaggacctcgagtggcgcccgagcgtcgaccactcgcaccgcgagcggatcgtc
gcgttctacgaccagctgtggcgcgacaacgtcacggccgacctcgtgcaccccgaggcc
gacctcagcgggtaccgcatggtcctcgccccggcctcgtacctgctcaccgacgcgggc
gcggccaacctcaccgccttcacggcggccggcgggacgctcgtggtctcgtgcttctcc
gggctggtcgacgagaacgacgccgtccgtgcggggggcctcgtggccgcgctgcacgac
gtgctcggcgtgcgggtcgacgagctgctgccgctgcgcgagggcgagaccctcgccctg
tccggcgggcgcttcgacgggctcgaggccgacgtgtggtccgaggacctcgtggtcacc
acggccgacgtcgccgcgacctacgcgagcgggccggccgagggtgaggccgcgatcacg
cgcaacgtccacggcgacggcgtcgcctggtacacctcgacgcgcctcacgggggctgcg
ctcaccgcgttcctcgacggcgcctacgccgacgcgcgcctggtgcccgagcgttccctg
cccgagggtgtggaggtcgtgcgtcgccgctcgaccgacggccgctcggagtacacggtc
gtcctcaaccacggcaccgaggacgtcctggtcccgggtgcgggtcgcgtgatcgtcggt
gacgaggtcgacgggacgccgcgcgtgccggccggcggggtcgccgtggcggtctccgag
atcggctga

DBGET integrated database retrieval system