KEGG   Sanguibacter keddieii: Sked_11160Help
Entry
Sked_11160        CDS       T01214                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ske  Sanguibacter keddieii
Pathway
ske00473  D-Alanine metabolism
ske00550  Peptidoglycan biosynthesis
ske01100  Metabolic pathways
ske01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ske00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sked_11160
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sked_11160
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sked_11160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ske01011]
    Sked_11160
Enzymes [BR:ske01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sked_11160
Peptidoglycan biosynthesis and degradation proteins [BR:ske01011]
 Precursor biosynthesis
  Amino acid ligase
   Sked_11160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACZ21060
UniProt: D1BDJ8
LinkDB All DBs
Position
1294686..1295888
Genome map
AA seq 400 aa AA seqDB search
MATVSESQPPTPASAPAPALRADASGDLPGEHRRPRVVLLFGGRSGEHVISCATAAGVMR
AIDRDRYDVVPVGITRTGQWVLVEDDPDRWAITDGRLPEVDATGTEVLLPLAVGQTALRV
LEAGALPRVLGDVDVVFPLLHGPFGEDGTLQGMLELADVRYVGAGVLASAVGMDKHFMKL
VLAGQGLPVGPYTVVPPGEWDRDAEAVTARVAGLGLPVFVKPARAGSSLGISKVDDLADL
PAAVAEARRHDPKVIVEAGIVGREIECAVLGGRRGERARASLPGEIQVTDTTHAFYDFEA
KYLSEQSVELTCPADLSPELVAEVQDVAVRTFEAVSGEGLSRVDVFVTEAGEVVVNEINT
MPGFTPFSMYPRMWDRSGLPYAELITELVELALERETGLR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgtctcagaatcccagccccccacccctgcgtccgcaccggcgcccgctctg
cgcgccgacgcctcgggcgacctgccgggtgagcaccgtcgtccccgcgtcgtgctgctg
ttcggcggacgctccggcgagcacgtcatctcgtgcgccacggccgccggggtcatgcgc
gccatcgaccgcgaccgctacgacgtggtgcccgtggggatcacgcgcaccggccagtgg
gtgctcgtcgaggacgaccccgaccgctgggccatcaccgacgggcgtctccccgaggtc
gacgcgaccggcaccgaggtgctgctgccgctcgccgtcggccagaccgcgctgcgcgtc
ctcgaggccggggcgcttccgcgggtcctcggcgacgtcgacgtcgtcttcccgctgctc
cacgggcccttcggggaggacggcaccctccaggggatgctcgagctcgccgacgtccgc
tacgtcggcgccggcgtcctcgcctcggccgtgggcatggacaagcacttcatgaagctc
gtgctggccggccaggggctgccggtgggcccgtacacggtcgtcccgccgggggagtgg
gaccgcgacgccgaggccgtgaccgcccgcgtcgccgggctcgggctgcccgtgttcgtc
aagcccgcgcgcgccggctcgagcctgggcatcagcaaggtcgacgacctcgccgacctg
ccggccgccgtcgccgaggcccgtcggcacgacccgaaggtgatcgtcgaggccggcatc
gtcggccgcgagatcgagtgcgccgtgctcggcggtcgccgcggcgagcgcgcccgcgcg
tccctgcctggcgagatccaggtgaccgacaccacccacgccttctacgacttcgaggcc
aagtacctcagcgagcagagcgtcgagctcacctgccccgcagacctcagccccgagctg
gtcgccgaggtgcaggacgtcgccgtgcggaccttcgaggccgtctcgggcgaggggctc
tcgcgcgtcgacgtgttcgtcacggaggcgggcgaggtcgtcgtcaacgagatcaacacg
atgccgggcttcacgcccttctcgatgtacccgcgcatgtgggaccgcagcggcctgccg
tacgccgagctcatcaccgagctcgtcgagctcgccctcgagcgcgagaccggtctgcgc
tga

DBGET integrated database retrieval system