KEGG   Sanguibacter keddieii: Sked_37720Help
Entry
Sked_37720        CDS       T01214                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent, monomeric type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ske  Sanguibacter keddieii
Pathway
ske00020  Citrate cycle (TCA cycle)
ske00480  Glutathione metabolism
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
ske01200  Carbon metabolism
ske01210  2-Oxocarboxylic acid metabolism
ske01230  Biosynthesis of amino acids
Module
ske_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ske_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ske00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sked_37720
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sked_37720
Enzymes [BR:ske01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Sked_37720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ACZ23655
UniProt: D1BGD8
LinkDB All DBs
Position
complement(4214015..4216225)
Genome map
AA seq 736 aa AA seqDB search
MSKIIYTYTDEAPMLATHSFLPVVSAFAGTAGVELETRDISLAGRIIAAFPERLTDAQRI
GDALAELGELATTPEANIIKLPNVSASLPQLKAAIAELQAQGYDLPDHPDAPATDADEDV
RARYDKIKGSAVNPVLREGNSDRRAPLSVKEYVRKNPHRMGAWTADSKTNVATMGHDDFF
SNEKSVVLDADDVLRIEHVSASGDVTVLHPGVKVLAGEVVDASFLDVAELHTFLADAIAR
AKAEDVLFSVHLKATMMKVSDPIIFGHVVRAFFPAVFEQYGADLEAAGLSPNNGLGGILD
GLAALPNGDEIRAAFDKGLADGPRLAMVNSDKGITNLHVPSDVIVDASMPAMIRTSGHMW
GPDGSEQDTIAVIPDSSYAGIYQAVIDDCRANGAYDPTTMGTVPNVGLMAQKAEEYGSHD
KTFEVAEAGTVRVVNQAGEALLEHEVRAGDIWRACQTKDVAIRDWVKLAVNRARATGTLT
VFWLDEKRAHDANLIKKVEAYLPEHDTTGLDIRVLAPAEATTLSVERIRRGEDTISVTGN
VLRDYNTDLFPILELGTSAKMLSIVPLLNGGGLFETGAGGSAPKHVQQLVEENYLRWDSL
GEFLALAASFEHFADVNSNEKARVLGATLDRATGTFLLENKSPGRKLGTIDNRGSHFFLA
LFWAEELAQQTDDADLAAAFGPLAASLRADEQTIVDELVAVQGSPAEIGGYYKVDAAKTD
AVMRPSATFTAALAAL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcatctacacgtacaccgacgaggcgccgatgctggcgacccactcgttc
ctccccgtcgtcagcgccttcgccggcaccgccggtgtcgagctcgagacgcgcgacatc
tccctcgccggtcgcatcatcgcggccttcccggagcggctcaccgacgcgcagcgcatc
ggcgacgcgctcgccgagctcggcgagctcgccacgacgcccgaggcgaacatcatcaag
ctgcccaacgtctcggcgtcgctgccgcagctcaaggccgcgatcgcggagctccaggcc
cagggctacgacctccccgaccaccccgacgcgcccgccaccgacgccgacgaggacgtc
cgcgcgcgctacgacaagatcaagggctcggcggtcaaccccgtgctccgcgagggcaac
tcggaccgccgcgcaccgctctccgtcaaggagtacgtgcgcaagaacccgcaccgcatg
ggtgcctggaccgccgactcgaagacgaacgtcgcgaccatgggccacgacgacttcttc
tccaacgagaagtcggtcgtcctcgacgccgacgacgtcctgcgcatcgagcacgtctcc
gcctccggcgacgtcaccgtcctgcacccgggcgtgaaggtcctcgccggtgaggtcgtc
gacgcgtcgttcctcgacgtcgccgagctgcacaccttcctggccgacgcgatcgcccgg
gccaaggccgaggacgtcctgttctcggtgcacctcaaggccacgatgatgaaggtctcc
gacccgatcatcttcggccacgtggtccgcgccttcttcccggccgtgttcgagcagtac
ggcgctgacctcgaggctgcgggcctcagcccgaacaacggcctcggagggatcctcgac
ggtctcgccgccctgccgaacggcgacgagatccgtgccgccttcgacaagggcctcgcc
gacggcccgcgcctcgcgatggtgaactcggacaagggcatcaccaacctccacgtgccg
agcgacgtcatcgtcgacgcgtccatgcccgcgatgatccgtacgtccggccacatgtgg
ggaccggacggcagcgagcaggacaccatcgcggtgatcccggactcgagctacgccggc
atctaccaggccgtcatcgacgactgccgcgcgaacggcgcctacgacccgacgaccatg
ggcaccgtccccaacgtcgggctcatggcccagaaggccgaggagtacggctcgcacgac
aagaccttcgaggtcgccgaggccggcaccgtgcgtgtggtcaaccaggcgggcgaggcg
ctcctcgagcacgaggtccgcgccggcgacatctggcgcgcctgccagaccaaggacgtg
gccatccgcgactgggtcaagctcgccgtcaaccgtgctcgtgcgaccgggaccctcacg
gtcttctggctcgacgagaagcgtgcccacgacgccaacctcatcaagaaggtcgaggcg
tacctgcccgagcacgacaccaccgggctcgacatccgggtgctcgcccccgccgaggcc
accacgctctcggtcgagcgcatccgccgcggcgaggacaccatctcggtgaccggcaac
gtgctgcgcgactacaacacggacctgttcccgatcctcgagctcggcacgagcgccaag
atgctctcgatcgtgccgctgctcaacggcggtgggctcttcgagaccggcgccggcggc
tccgccccgaagcacgtccagcagctcgtcgaggagaactacctccgctgggacagcctc
ggcgagttcctcgcgctcgcggccagcttcgagcacttcgccgacgtgaacagcaacgag
aaggcccgcgtgctcggtgcgaccctcgaccgtgccaccggcacgttcctgctcgagaac
aagtcgcccggacgcaagctcgggacgatcgacaaccgcggctcgcacttcttcctcgcg
ctcttctgggccgaggagctcgcgcagcagaccgacgacgcggacctcgcggccgccttc
ggcccgctcgccgcgtcgctgcgcgccgacgagcagacgatcgtcgacgagctggtcgcc
gtgcagggctcgccggcggagatcggcggctactacaaggtcgacgccgccaagacggac
gccgtgatgcgaccgtcggccaccttcaccgcggcgctcgccgcgctctga

DBGET integrated database retrieval system