KEGG   Shewanella khirikhana: STH12_00265
Entry
STH12_00265       CDS       T06711                                 

Gene name
pbpG_1
Definition
(GenBank) Penicillin-binding protein 2D
  KO
K03814  monofunctional glycosyltransferase [EC:2.4.1.129]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_00265 (pbpG_1)
Enzymes [BR:skh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     STH12_00265 (pbpG_1)
Glycosyltransferases [BR:skh01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   STH12_00265 (pbpG_1)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   STH12_00265 (pbpG_1)
SSDB
Motif
Pfam: Transgly Wzz
Other DBs
NCBI-ProteinID: AZQ09417
UniProt: A0A3S9L1G3
LinkDB
Position
322952..323710
AA seq 252 aa
MSGDAMNGSDVPVPSEPKRSFLSRIWRGLWRWLFKLTVIFVLLSVALVAAVTFFDPPTWA
WRIDRSLFPPKAGIEVSHSWRPLENISPNLQLAVIASEDQRFPLHYGVDFEAIKIALADR
EPGERLRGASTLTQQTAKNLFLWSSRSLLRKSLEAWFALLLDTIAGKRRTLELYLNIVEF
GPGIYGAEAASVHYFGKSASRLSVREAALLAALLPNPWEYRISPPTEYMSGRADWISRQM
GQLGAATLKELD
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctggtgatgcgatgaatggaagtgatgtccctgtgcccagcgagccgaaacgatcc
tttttaagccgcatctggcgcggcctttggcgttggctgtttaagctgactgtaattttt
gtgctgctcagcgtcgcactggttgcggccgttaccttcttcgacccgcccacctgggcc
tggcgtatcgaccgcagcttgtttccacccaaggcggggatagaggtcagccacagctgg
cggccgctggagaatatctcccccaatctgcaactggcggtgattgcctctgaggatcag
cggtttccactgcattatggggttgattttgaagcgataaaaatcgctttggcagacagg
gagcccggagagcgactgcgcggcgccagcactctgacccagcaaacagccaagaatctg
tttttgtggtcatcccgcagtttgctgcgtaagagccttgaggcctggtttgcgctgctg
ctggataccattgccggtaaacgccggacgctggagctttacctgaatattgtggagttt
ggccccggcatttatggcgccgaggctgcctcggtgcattactttggcaagagtgcttcc
aggctcagtgtacgtgaagcggcgctgctggcggcgctgttgccaaacccttgggaatac
cgtatcagtccgcccaccgaatatatgtccggccgtgccgactggattagccgccagatg
ggacagcttggtgccgccaccctgaaggagctggattag

DBGET integrated database retrieval system