KEGG   Shewanella khirikhana: STH12_00359
Entry
STH12_00359       CDS       T06711                                 

Gene name
uppP
Definition
(GenBank) Undecaprenyl-diphosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_00359 (uppP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_00359 (uppP)
Enzymes [BR:skh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     STH12_00359 (uppP)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Precursor biosynthesis
  Diphosphatase
   STH12_00359 (uppP)
SSDB
Motif
Pfam: BacA TauE CemA
Other DBs
NCBI-ProteinID: AZQ09510
UniProt: A0A3S9L1M8
LinkDB
Position
420687..421487
AA seq 266 aa
MDTLQVIILALIQGLTEFLPISSSAHLILPAQLFGWEDQGLSFDVAVHIGSLLAVVIYFR
KEIVAMLTAWLASIFKGKQSDDSKLAWWIILATIPAVGVGFAAKDLVETHLRGPGVIAVT
TVIFGLLLWFADRIAKDELTEYQTGWRKALLIGIAQAMALIPGTSRSGITITAALMLGLK
REAAARFSFLMSIPVILGAALLMTKDIISEGHAVDWHALGLGVVLSFVAAYTCIYFFLKI
ISRMGMTPFVIYRLALGVFLCGFIFL
NT seq 801 nt   +upstreamnt  +downstreamnt
atggataccttgcaggtcatcattcttgccctcattcagggcctgaccgaatttttgccc
atttccagctcggctcacctgattttgccggcgcagctgtttggctgggaagatcagggg
ctgtcgttcgatgtggcggtgcacattggctcgctgctggcggtagtgatttatttccgt
aaagaaatcgtcgccatgctcaccgcctggcttgccagcatcttcaaaggcaagcaaagc
gacgacagcaaactcgcctggtggattatcctcgcaaccattcccgccgttggggtggga
tttgccgcaaaagatctggtggaaacccacctgcgcggccccggcgtgattgcggtgacc
acggtcatctttggcctgctgctgtggtttgccgatcgcattgccaaagatgagctcacc
gaataccagaccggctggcgcaaggcgctgctgattggtattgcccaggccatggcgctt
attccgggtacttcccgcagcggtatcaccattaccgcggcgctgatgctcggccttaag
cgcgaggcggcggcccgctttagtttcctgatgtctattccggtgatcctgggtgcggcg
ctgctgatgaccaaggatattatcagcgaaggtcatgccgttgattggcatgcgctgggg
ctgggcgtggtgctttcctttgtggcggcctatacctgtatttatttcttccttaaaatt
atcagccgcatgggcatgacgccttttgtgatttatcgcctggcccttggggtatttctc
tgtgggtttatcttcctgtaa

KEGG   Shewanella khirikhana: STH12_03114
Entry
STH12_03114       CDS       T06711                                 

Definition
(GenBank) undecaprenyl pyrophosphate phosphatase
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_03114
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_03114
Enzymes [BR:skh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     STH12_03114
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Precursor biosynthesis
  Diphosphatase
   STH12_03114
SSDB
Motif
Pfam: PAP2 PAP2_3 PAP2_C
Other DBs
NCBI-ProteinID: AZQ12178
UniProt: A0A3S9L9A8
LinkDB
Position
complement(3523000..3523512)
AA seq 170 aa
MLTHLTELDRRGFQLIHGGASRHGLQRSSLLVSATGDGPLYLYLSIGLLLFDSQGNQLFR
LALLAFALELPLYLLLKNSIRRTRPCHAALGFECSFEPSDKFSLPSGHTAAAFVMATAIA
DVYPAALFAAYGWACLIGLSRVALGVHYPMDIAAGAALGTVSVAWANSFY
NT seq 513 nt   +upstreamnt  +downstreamnt
atgctcacacatctgaccgagctcgacaggcgcggttttcagctgatccacggcggtgct
tcccgacatggattacagcgcagctctttgctggtgtctgccaccggcgatggtcccctc
tacttatacctgagtatcggcttactgctgtttgactctcagggtaaccaattgttcagg
ctggcattattggcctttgctctggaacttcccctctatttgttgctgaaaaacagcatt
cgtcgaacccgcccgtgccacgcggccctggggttcgagtgcagttttgagccttccgat
aaattcagtctgccctcggggcacacggcggcggcctttgtgatggccaccgcgattgcc
gatgtttaccccgcggcactgtttgcagcctatggctgggcctgtctgattgggctctcg
cgggtggcgctgggggtgcattatcccatggatatcgctgccggtgcggctctgggcaca
gtatcggttgcgtgggccaacagcttctattga

DBGET integrated database retrieval system