KEGG   Shewanella khirikhana: STH12_00698
Entry
STH12_00698       CDS       T06711                                 

Gene name
ispU
Definition
(GenBank) Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
skh00900  Terpenoid backbone biosynthesis
skh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_00698 (ispU)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STH12_00698 (ispU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:skh01006]
    STH12_00698 (ispU)
Enzymes [BR:skh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     STH12_00698 (ispU)
Prenyltransferases [BR:skh01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   STH12_00698 (ispU)
SSDB
Motif
Pfam: Prenyltransf AP_endonuc_2 DUF4618
Other DBs
NCBI-ProteinID: AZQ09837
UniProt: A0A3Q9E5U2
LinkDB
Position
805870..806670
AA seq 266 aa
MSSNREITAEPTTESMPQEVSELVNQSLPRHVAIIMDGNGRWAQAQGKPRVMGHKAGVKA
VRRAVSTARQLGIKSLTLFAFSSENWRRPDTEVSLLMELFFTVLRRELKLLDQNGVRLNI
IGDTSRFSERLQKQIRDAEAKTANNTELVLNVAANYGGRWDILQAANQLAQKLASGEIDS
SQFTEEALSQHLCMQNQGEVDLMIRTGGDFRISNFVLWQAAYAELVFTDTLWPDFDEQCF
KDAIALFASRQRRFGLTGSQIEEMRA
NT seq 801 nt   +upstreamnt  +downstreamnt
atgtcttccaacagggaaattaccgctgaaccgaccacagagtctatgcctcaagaggtc
tctgaactggtcaatcagtccctgccacgacatgtcgcaatcatcatggacggtaacggc
cgttgggcgcaggctcagggcaaacccagggtgatggggcataaggcaggggtgaaggcg
gtgcgccgcgctgtaagtaccgcgcgccagcttggcatcaagtctttgactctatttgca
ttttcaagtgagaactggcgcaggccagataccgaagtcagcctgctgatggaactgttt
ttcacagtgctgcgccgtgaactcaagttgctcgaccaaaatggggtacgcctgaacatc
attggcgataccagccgtttctccgagcgtctgcaaaagcaaattcgcgatgccgaggcc
aaaacggccaacaataccgagctggtgttgaacgtggcagccaactacggcggccgctgg
gatatacttcaggcagcgaatcagttggcacaaaagctcgcatctggtgaaatcgacagc
agtcagtttaccgaagaggcattaagtcagcatttgtgcatgcaaaatcaaggggaagtt
gatttaatgatccgcactggtggcgacttccgcatcagcaactttgtgctctggcaggcg
gcttacgctgagttggtgtttactgacaccctgtggcctgatttcgacgagcagtgtttt
aaagacgccatcgccctgtttgcgagtcgtcagcgccgtttcggattgactggaagtcaa
atcgaagaaatgcgcgcctga

DBGET integrated database retrieval system