KEGG   Shewanella khirikhana: STH12_01593
Entry
STH12_01593       CDS       T06711                                 

Gene name
ddl_1
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
skh  Shewanella khirikhana
Pathway
skh00473  D-Alanine metabolism
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
skh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    STH12_01593 (ddl_1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_01593 (ddl_1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    STH12_01593 (ddl_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_01593 (ddl_1)
Enzymes [BR:skh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     STH12_01593 (ddl_1)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Precursor biosynthesis
  Amino acid ligase
   STH12_01593 (ddl_1)
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp DUF3110
Other DBs
NCBI-ProteinID: AZQ10701
UniProt: A0A3Q9E5H5
LinkDB
Position
1832568..1833578
AA seq 336 aa
MKKYNLVLLCGGGGSEHDISLLSAKYFEACLSDHPRFNTLWLELSANGEYRTKEGEIVEL
TNRRDIRFADDTKAAWPVDYIIPCIHGFPGETGDIQSWFNLIQLPYFGCGSEASSNCFNK
ITAKMWFSALGIPNTPYLYLDEPSDDAIARVERAFDEWNGVFIKAASQGSSVGCFPATKR
EDIPALVKKAFEYAPFVVVEKTIVARELEVAVYEYDGELVATRPGEIVCAANTFYSFEEK
YDAKSQAVTHVEAPDVDEATVEAIRDYALRAFKGMKLRHLSRIDFFLTRDNQILLNEINT
FPGLTQISMFPKMLANHGHDFTTFLEKAILAELEGA
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaaaaaatacaatctggtgctgctttgcggcggcggtggcagcgagcatgacatttcc
ttgttgtcggccaaatactttgaagcctgcctcagtgaccatccccgcttcaacaccctg
tggctggaactgagcgccaacggcgagtaccgcaccaaggaaggcgagattgtcgagctg
accaaccgccgcgacattcgctttgccgatgacaccaaggcggcctggccggtggattac
atcatcccttgtattcacggtttccccggcgaaaccggcgatattcagtcctggtttaac
ctcatccaattgccctactttggctgcggctcagaagcgtccagcaattgtttcaacaag
atcaccgccaagatgtggttcagcgcccttgggatccccaacaccccttacctgtacctg
gacgagcccagtgatgacgctatcgcccgggtagaacgtgcattcgatgaatggaatggt
gtctttatcaaggccgcgagccaaggctcatctgtgggctgcttcccggccaccaagcgt
gaagacattccggcgctggtcaaaaaagccttcgagtacgcgcctttcgtggtggtggaa
aaaaccattgtcgcccgcgagctggaagtggcggtgtacgaatacgatggcgagctggtg
gccacccgtccgggcgagattgtttgtgcggccaacaccttctacagctttgaagaaaaa
tacgatgccaagagccaagcggtaacccatgtggaagcgcccgatgtggatgaagccacg
gttgaggccatccgcgactatgcactcagggcatttaaaggcatgaagctgcgccatctg
tcgcggattgacttcttcctcaccagagacaaccaaatcctgctgaatgaaatcaatacc
ttccccggcctaacccagatttccatgtttcccaagatgctggccaatcacggccatgac
tttaccaccttccttgaaaaggccattctggccgagctcgaaggtgcataa

DBGET integrated database retrieval system