KEGG   Shewanella khirikhana: STH12_02391
Entry
STH12_02391       CDS       T06711                                 

Gene name
spoVD
Definition
(GenBank) Stage V sporulation protein D
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
skh01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_02391 (spoVD)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    STH12_02391 (spoVD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_02391 (spoVD)
Enzymes [BR:skh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STH12_02391 (spoVD)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   STH12_02391 (spoVD)
SSDB
Motif
Pfam: Transpeptidase PBP_dimer EFG_C
Other DBs
NCBI-ProteinID: AZQ11470
UniProt: A0A3Q9E9G1
LinkDB
Position
2724466..2726322
AA seq 618 aa
MTPRKRVAMHDHAAEAALFRRRAIFTFLCVLALFGLLLTNLYHLQVTSYADYTTRSNDNR
IRVTPVAPSRGLIYDRNGVLLAENQPVYSLELVPEKVKNVAETLERLSQVIPLSDEEQQD
FLEALKYHRRFKPLTLKNNLTEAEVAAFSVDQHHFPGVRVEAGLKRFYPHGELLTHVLGF
VGKINAKDRAALERADRWGDYTASKDIGKQGVEKYYENLLHGKPGHLEEEVNNRGRTIRT
LKTEPPEPGQDLYLTLDINLQKKAMELLSGRRGTIVAIDPQDGGILALVSSPSYDPNLFV
QGISSKNYSALLNDKSRPLINRATQGLYAPASTIKPHMALLGLEEQVITERTRIWDPGYW
QMPGVERKWRDWKKWGHGYVDVYHAIVDSCDIFFYDMVHKMGIDKIANFMNQFGFGESTG
VDIFEESAGIMPSSDWKRIRHNQPWYPGDTISVGIGQGYWTATPIQLANATAILANRGKR
YVPHLLKAMKDQSAKIERPPEEMPPVSLKNPRNWEIINEAMRQTAHKSRFTDASYTAAMK
TGTAQVFSVAQDAKYDHDSVAEHLRDNALIVAYAPFENPKIVLSVVLENAGWGGANAGPV
ARAMLDEFMLHEQWKVQP
NT seq 1857 nt   +upstreamnt  +downstreamnt
gtgacgccaagaaaacgggtagccatgcacgatcacgccgccgaggcagctctgtttcgg
cgacgggccatctttacctttctgtgtgtgctggcactgtttgggctattgctgaccaac
ctgtatcacctgcaggtgacctcttacgccgactacaccacccgctccaacgataaccgt
atccgggtcacgccggtggcgccaagccgcggcctgatttacgaccgcaacggggtgctg
ctggcagaaaaccagccggtgtattcccttgagctggtgcccgagaaggtgaaaaacgtt
gccgaaactctggagcgcctgtcgcaggttatccctttaagcgatgaggagcagcaggac
tttctcgaggcgctgaaataccaccgccgctttaagcccctgacactgaaaaacaacctc
actgaggccgaagtagccgctttcagtgtggatcagcaccactttcccggcgtgcgggtg
gaagccggtctgaagcgcttttacccccatggtgaactcctaacccatgtgctgggcttt
gtaggcaaaatcaacgccaaggacagagccgcgcttgagcgggccgaccgctggggcgac
tacaccgccagcaaagatattggcaagcaaggtgttgaaaagtattacgaaaatctgctt
cacggcaaacctggccacctcgaagaagaggtgaacaaccgtggccgtaccatacgcacc
ctgaaaacagagccgcctgagcctggccaggatctgtatctgaccctggatatcaatctg
cagaaaaaggcgatggagctgctgtccggtcgccgtggcaccatagtggccatcgatccc
caggacggtggcattttggcgctggtctcgagcccgtcatacgaccccaacctgtttgtg
caggggatcagctcgaaaaattacagtgcactgctgaacgacaagtcacggccgctgatt
aaccgcgcgactcagggcctgtacgcccccgcatccaccatcaagccgcatatggcgctg
ctggggctggaagagcaggtgattaccgagcgcacccgaatttgggatccaggttactgg
caaatgcccggcgttgagcgcaagtggcgtgactggaaaaaatggggccacggctatgtg
gacgtgtaccatgccatcgtcgattcctgcgatatcttcttctacgacatggtgcataaa
atgggtatcgataagatagccaactttatgaatcagtttggttttggtgaaagcaccggc
gtggatatttttgaagagtccgccggcataatgccgtcctctgactggaaacgtattcgc
cacaatcagccctggtatcccggcgacaccatctccgtgggtatcggtcagggctactgg
actgcaacgccaatccagctcgcaaatgccaccgccattttggccaaccgcggtaaacgc
tatgtgccgcatttgctcaaagcgatgaaagaccagagcgccaaaatcgagcgaccaccc
gaagaaatgccaccggtgagcctgaaaaacccgcgcaactgggaaatcatcaacgaagcc
atgcgtcaaaccgcccataagtcgcgctttaccgatgccagctacaccgcggccatgaaa
acaggtacggctcaggtgttctcggtggctcaggacgccaagtacgaccatgactcggtg
gccgagcacctgcgcgataacgccctgattgtggcctatgcgccgtttgaaaatccaaaa
attgtcctgtcggtggtgctggaaaacgctggctggggcggcgccaacgcaggcccggtg
gcccgcgccatgttggatgaatttatgctgcacgagcagtggaaggtacagccatga

KEGG   Shewanella khirikhana: STH12_04038
Entry
STH12_04038       CDS       T06711                                 

Gene name
ftsI
Definition
(GenBank) Peptidoglycan synthase FtsI precursor
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
skh01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_04038 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    STH12_04038 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_04038 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:skh03036]
    STH12_04038 (ftsI)
Enzymes [BR:skh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STH12_04038 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   STH12_04038 (ftsI)
Chromosome and associated proteins [BR:skh03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    STH12_04038 (ftsI)
SSDB
Motif
Pfam: Transpeptidase PBP_dimer Jun
Other DBs
NCBI-ProteinID: AZQ13072
UniProt: A0A3S5HR22
LinkDB
Position
4573058..4574794
AA seq 578 aa
MSRQAKRNQKAQPIPWRLYVVVGFVCLLFTSLVGRAAYIQLIEPDRLRHESDMRTLRTSS
SEVQRGLITDRNGEMLAVSVPVQAVYADPKEVHDKDGFADMRRWQALADVLHEKPDELIA
RVQDNPAKRFTYLKRQITPAVADYIRQLKLPGVYLKPESRRYYPAGEITAQLIGVTNIDD
VGIEGIESTYNNWLTGTPSKQKVRKSRDGHVVERLDIVQEGESPNDLVLSIDQRIQQLAY
RELKRATEMHQATSGSVVVIDIHTGEVLAMANTPSYNPNSRNDWQSFKMRNRAVTDTFEP
GSTVKPFVVAAALESGTVKQSEVISTSPGWMRIGGRQVRDSRNYGDMSLTKILVKSSNMG
VAKLSLGMPVEQLLGTYYSIGLGNYSGIGLPGESAGLIREKHRWSDFERATLAFGYGLTT
TTLQLARMYATLGNGGILYPATILKLKQKPEGQQVISERVADEVLHMLVGVTEQGGTALK
AHIDGYPVAGKTGTSRKAVAGGYGDDYLATFAGVAPVNNPRLAIAVVINEPKGDRYYGGD
VSAPVFAKVMAGALQMLNVEPISSREQMQLAANGREAE
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgagcaggcaggcaaaacgcaatcagaaagcacaacccattccatggcgtttgtacgtg
gtggtgggttttgtgtgtttgctgtttaccagtctggtgggccgtgccgcctatattcaa
ttgattgaacccgaccgtctgcgtcacgaaagcgatatgcgcaccctgcgtaccagcagc
agcgaagtgcagcgcggccttatcaccgacagaaacggtgaaatgttggccgtgagtgtg
cctgtgcaggccgtgtatgccgatcccaaagaagtgcatgacaaagacggcttcgccgat
atgcgccgctggcaggcgctggccgatgtgctgcacgaaaagcccgacgagctgattgcc
cgggtacaggacaatcctgccaagcgttttacctacctcaagcgtcaaattactccggcg
gtggcggattatatccgtcagctcaagctgcccggcgtttatctcaagcctgaatcgcgc
cgctattaccctgcaggtgaaatcacggctcagctgattggcgtgaccaatatcgacgat
gtgggcatcgaaggtattgaaagcacctacaataattggctcacaggcacgccctctaag
cagaaagtgcgtaaatcccgtgatggtcacgtggtggagcgccttgatattgttcaggaa
ggtgaaagcccgaacgatctggtgctcagtatcgatcagcgtattcagcagctggcttat
cgcgagcttaagcgcgccaccgagatgcatcaggccacttcgggttctgtggtggtgatt
gatatccataccggcgaagtgctggcgatggccaacaccccgtcatacaaccccaatagc
cgcaacgactggcaaagcttcaagatgcgtaatcgcgccgtgaccgacaccttcgagccc
ggctccactgtgaagccctttgtggtggcagcggcgctcgagtccggtactgtcaagcaa
agcgaagtgatttccacgtcgccgggctggatgcggattggtggtcgccaggtgcgtgac
tcgcgcaactatggcgatatgtcactaacgaaaattctcgttaaatcaagcaatatgggc
gtggccaaactgtcactcggcatgccggttgagcagcttttggggacttactactccata
ggtttgggcaattactccggcataggtttgccgggtgaaagcgccgggcttatccgtgaa
aagcatcgctggtctgattttgaacgtgcgaccctggccttcggctatggccttaccacc
accacgctgcaactggcgcggatgtacgccactttgggcaatggtggcatcctgtatccc
gcgaccattctcaaactcaaacaaaagccggaaggtcagcaggtgatttccgagcgggtt
gccgacgaagtgctgcacatgctggtgggcgtaaccgagcagggcggtactgcgcttaag
gcccatatcgatggctatcctgttgccggtaaaaccggtaccagccgtaaagccgtggcc
ggtggctatggtgatgattacctggcaacgtttgccggcgtggcgccggtgaacaaccct
cggcttgccattgccgtggtgatcaacgagcccaagggcgacagatattacggcggcgac
gtgtcggcgcctgtgtttgccaaggtaatggctggcgcgctgcaaatgctgaatgtggag
cccatcagctcccgcgaacagatgcaattggctgccaacggacgggaggccgaatga

DBGET integrated database retrieval system