KEGG   Shewanella khirikhana: STH12_02395
Entry
STH12_02395       CDS       T06711                                 

Gene name
dacA
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacA precursor
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_02395 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:skh01002]
    STH12_02395 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_02395 (dacA)
Enzymes [BR:skh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STH12_02395 (dacA)
Peptidases and inhibitors [BR:skh01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   STH12_02395 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   STH12_02395 (dacA)
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 CytoC_RC
Other DBs
NCBI-ProteinID: AZQ11474
UniProt: A0A3S9L7D7
LinkDB
Position
2729473..2730543
AA seq 356 aa
MAAKAYVLMDYHTGQIIAEEHAYEQLNPASLTKMMTSYVIGHEMKVGNISPEDDVQISKN
AWSKNFPDSSKMFIEVGKTVKAEDLNRGIIIQSGNDACVAMAEHIAGTEDAFVDMMNSWA
KQLGMTDSYFENSHGLDSDNHKTTAYDMAILGAALIRDVPDEYRIYAEKEFTFNGIKQYN
RNGLLWDKSMNVDGIKTGHTSGAGYNLVASATQDNMRLISVVMGAKSEAARKAESKKLLS
YGFRFFETVTPYKAGDSFVNQKIWYGDRESVDLGVATDTPLTIRRGKGKDLQANFELTKP
LEAPVAKGEVVGRVYFQLDGKDIAQFPLVTLQEVNEGSWFSKLMDYFKQLFASWFS
NT seq 1071 nt   +upstreamnt  +downstreamnt
gtggccgccaaggcctatgtgctgatggactatcacaccgggcagatcattgcagaagag
catgcctacgagcagcttaaccctgccagtctgaccaagatgatgaccagttatgtgatt
ggtcatgaaatgaaagtgggcaatatctcccccgaggacgatgtgcagatcagcaagaat
gcctggtcaaagaacttccctgactcttccaagatgtttatcgaggtaggtaaaacggtc
aaagccgaagatctcaaccgcggtatcatcattcagtcgggtaacgatgcctgtgtggcc
atggccgagcacattgccggcaccgaggatgccttcgtcgatatgatgaactcctgggcc
aagcaactgggcatgaccgacagctattttgaaaacagccatggtctggactctgacaat
cacaagaccaccgcttacgatatggcgattctcggcgcggcactgatccgcgatgttccc
gacgagtaccggatctacgccgagaaggaatttaccttcaacggcattaagcagtacaac
cgcaacggcctgttgtgggacaagagcatgaacgtggacggcatcaagaccggccacacc
tcaggcgcaggttataacctggtggcctccgcgacccaggacaatatgcgtctgatctcg
gtggttatgggcgccaagagtgaagctgcccgtaaggccgaaagcaaaaagctgctgtct
tacggattccgctttttcgaaaccgtgaccccatacaaagccggcgacagcttcgttaac
cagaaaatctggtacggcgatcgtgaaagcgttgatttgggtgtggccacagatacgcca
ctgaccattcgccgcggcaaaggcaaagatttgcaagccaactttgagctgaccaaacca
ctggaagcccctgtcgccaagggtgaagtggttggccgtgtctacttccagctggatggt
aaagacattgcccaattcccactggtcaccctgcaggaagtgaacgaaggcagctggttc
tccaaactgatggactacttcaagcagctcttcgccagctggttcagctaa

DBGET integrated database retrieval system