KEGG   Shewanella khirikhana: STH12_02874
Entry
STH12_02874       CDS       T06711                                 

Gene name
mrcB
Definition
(GenBank) Penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_02874 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:skh01003]
    STH12_02874 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_02874 (mrcB)
Enzymes [BR:skh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     STH12_02874 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STH12_02874 (mrcB)
Glycosyltransferases [BR:skh01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   STH12_02874 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   STH12_02874 (mrcB)
SSDB
Motif
Pfam: Transgly Transpeptidase UB2H
Other DBs
NCBI-ProteinID: AZQ11943
UniProt: A0A3S9L8N9
LinkDB
Position
complement(3270799..3273147)
AA seq 782 aa
MTSEKRTSAKRTTEKSGAPRRKAPAKGKAKAAKPGVLWRIWSFLWKLTLVVLVLCAAYGI
YLDQQIARKFEGQKWHLPAQIYSRSMALYPGAAVSHHQMMAELKLLGYRKVANPRQVGEF
SASKTRIDLWRRPFLHPLGSQEAARVMISFDTLGVENVARHTDKRELAVFHLEPVLLDRI
IASDGEDRLFVARKEVPDTMVDALILVEDRSFYEHHGVNPFAILRAAFVNISAGRTVQGG
STLTQQLAKNFFLSSERSLIRKIREALMAIIIDFRYSKDEILEAYLNEVYMGQDKSRGVH
GMGLASQFYFGRPLNELTLAQQAFLIAVIKGPSYYNPWRYADRAQERRDLVLRLLMEAGK
ISVNDFQIAAESPLGLRPEGRPVHQKMPAFYAQVKKELALRWGDSLLNESGIKVYTTLDP
IAQEAAEKAVKDVMARIGKDTKELQAAMVVTDKFGGGIAAMVGDRNPSFEGYNRVSEMRR
PIGSLVKPFVYLTALEDNNYNLMTPLKDEPLTVTNKHGQAWSPQNYSKTFSGQVPLMQAL
YKSLNVPTVNLGLAVGVDSVINTLDDAGWRGEAINPYPSMLLGAVDGSPLMVAQIYQTLA
DNGRFRQLSTVTDVLDMNNEAILASRLPSEQSLEPAAAYLAQYVMTRVVAEGTGVRLGRA
FPNVTLAGKTGTSNDSRDSWFAGFDERNVAAVWVGRDDNGKTKLVGASGAMAIYQAFLEQ
RPPVGLRMTPPGDVVQGYFDANGNALEKGCPGAVALPAKVGSWNPARNCGKPLSWWQKIV
GG
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgacttcagaaaaacggacttcagcaaaacggaccacggaaaagagcggcgctccccga
cgtaaggcaccggccaaaggcaaggcgaaagcggccaagcccggcgtgctttggcgtatc
tggtcgtttttgtggaaactcaccctggtggtgttggtgctgtgcgccgcgtacggcatt
tatctggatcagcaaatagcccgcaaattcgagggccagaagtggcatctgcctgcgcag
atctacagtcgctccatggcgctctaccccggcgccgccgtgagtcatcaccagatgatg
gccgaactcaagctgctggggtatcgcaaggtggccaacccacgtcaggtgggggagttt
tcggcgtccaagacccgcattgacctgtggcgtcgccccttcttgcatccccttggcagc
caggaagcggcgcgggtgatgattagttttgataccctgggggtggagaacgttgcccgt
cacaccgacaagcgcgagctggcggtgtttcaccttgagcctgtgctgctggacagaatc
atagccagcgacggtgaagacaggctgtttgtggcccgcaaagaagtgcccgacaccatg
gtggatgcactcattctggtggaagaccgcagcttttacgagcaccacggggtcaacccg
ttcgcgattttgcgggctgcctttgtcaatatcagcgcaggccgcacagtgcagggcggc
tcgaccctgacccagcagctggcgaagaacttcttcctctccagtgagcgctcgcttatc
cgcaaaatccgcgaagccctgatggccatcatcatcgattttcgctacagcaaggatgag
atcctcgaggcctacctcaacgaagtctacatgggccaggacaagtcccgtggcgtacac
ggtatggggctggcatcgcagttctacttcggtcgtccactgaacgaactgaccctggcg
cagcaggcgtttttgattgcggtgattaaagggccgtcttactacaacccctggcgctat
gccgaccgggcgcaggagcgccgggatctggtgctgcggctgttgatggaagcgggcaaa
atcagcgtgaacgacttccagattgccgccgaatcgccgctgggcttaaggccggaaggt
cgtcctgtgcatcaaaagatgcctgcgttttacgctcaggtgaaaaaagagctggctctg
cgctggggtgacagtctgctcaatgagtcgggcatcaaggtgtacaccaccctcgacccc
atagctcaggaagcggccgaaaaagcggtgaaggacgtgatggcccgcattggcaaagac
accaaggagctgcaggcggccatggtggtaaccgataagtttggcggcggtatcgcggcc
atggtgggcgatcgtaatccaagctttgaaggttacaaccgggtcagcgaaatgcgccgc
ccgattggctcgctggtgaagccgtttgtttacctcaccgcccttgaagataacaactac
aacctgatgacgccgctgaaggacgagccgctgaccgtgaccaacaagcacggccaggcc
tggtcgccgcaaaattacagcaagaccttcagtggtcaggtgccactgatgcaggcgctg
tataagtcgctcaacgtaccgacggtgaatttggggctggcggttggcgtggattcggtc
atcaacaccctcgatgatgccggttggcgcggcgaggcgattaatccgtatccgtcgatg
ctgcttggcgccgtggatggctcgccgctgatggtggcgcagatttatcagaccctggcc
gacaatggtcgcttccgccagctgtccaccgtgaccgacgtgctggacatgaataatgaa
gccattctggcgagccgcctgccatcggagcagtcgttggagcctgctgccgcttacctt
gcccagtacgttatgacccgggtggtagcggaagggacaggtgttcgccttggccgcgcc
ttccccaacgtgaccctggccggtaagacgggtaccagtaacgacagccgtgactcctgg
tttgcagggtttgacgagcggaacgtggccgccgtttgggtgggtcgtgatgacaacggc
aagaccaagctggtgggcgccagcggtgccatggcgatttatcaggcgttccttgagcag
cgtccgccagtgggtctgcggatgacgccgcctggcgatgtggtgcagggctactttgat
gccaacggcaatgcgctggaaaaaggctgccccggcgccgtggcgctgccagccaaggtg
ggtagttggaacccggcccgcaactgcggcaagcctttgtcctggtggcagaaaatcgtt
ggcggttaa

KEGG   Shewanella khirikhana: STH12_03306
Entry
STH12_03306       CDS       T06711                                 

Gene name
mrcA
Definition
(GenBank) Penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
skh01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_03306 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    STH12_03306 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:skh01003]
    STH12_03306 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_03306 (mrcA)
Enzymes [BR:skh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     STH12_03306 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     STH12_03306 (mrcA)
Glycosyltransferases [BR:skh01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   STH12_03306 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   STH12_03306 (mrcA)
SSDB
Motif
Pfam: Transgly PCB_OB Transpeptidase
Other DBs
NCBI-ProteinID: AZQ12366
UniProt: A0A3Q9E9A5
LinkDB
Position
3762504..3765077
AA seq 857 aa
MKWLKRILIALFSLALLGVGAIVAAYFYVLPDLPDVATLKTVQLQTPLKIYSQDGKLISQ
YGEKRRIPVKLEDVPKPLLQAFLATEDARFYEHQGIDPVGIVRAFVVWMASGEKKQGAST
ITQQVARNFFLTRDKTIIRKVKEIFISFHIEDLLTKDEILELYVNRIYLGQRAYGVGAAA
QVYYGKDLHDLSLAEMAVIAGLPKAPSTLNPITSPDRALARRNVVLMRMREVGFINDSEY
ASAIEQPNTASYHGAEIDLYVPYVSEMARDYMIQKYGEEEAYTGGYNVYTTVSSDLQLKA
QKALRDNIYAYDERHGYRGGAEVLWSSEVPDTASISERLKKIANVQDLEPAAVINVQEQQ
ATVLRGNGETVTLPWQGIQWARKFITDTRQGSAPKAATEVLTAGERIWIRNNGEHWQLSQ
VPEVSSAIVSLDPHNGAIRALVGGYSFSQSQFNRVTQAKRQLGSNIKPFIYAATLEKGFT
LATLINNAPINKPDMSQGTAWRPKNSPDVYTGPTRMRVGLAQSINVMAVRALRYAGIDNT
VELLTRFGFDPNDLPRNESLALGSPSVTPLQVVNAFSVFANGGYLVEPFFIDRVETALGQ
VVEKTKPTLACDAPMPEETPEDQVLSQQPDSVVEALATAAITGEAPEMLAKATDVNLCGG
EGVRYAPRVLSEQNAFLITEALKSVIWGGGDFSKGTGWNGTAWRAARLLKRHDIAGKTGT
TNESRDTWFSGFNPDLVTTVWVGFDDHGRELGRTAWNANGAKDQISGAEAGAKTAGPAWN
QFMLMAIGDIPEKPSQPPAGIVSARIDYSSGKLSRRTDYTSGFEYFAAGTVPTDYANSAI
AEDNTTAPETTADDLFQ
NT seq 2574 nt   +upstreamnt  +downstreamnt
gtgaagtggctaaaacgtattctcattgccctctttagtctagccttgctgggcgtaggc
gctattgttgcggcatatttttatgttttgcccgacctgcccgatgtcgcgacccttaaa
acggtccagctgcagacaccgctgaagatatacagccaggacggcaaacttatttcacaa
tatggcgaaaagcgccgtattcccgtcaaacttgaagatgttcccaagccgctgctgcag
gcctttctggccacagaagacgcgcgcttttacgaacatcagggcattgaccctgtcggt
atcgtacgagccttcgtggtttggatggcctccggcgagaaaaaacagggtgccagtacc
attacccaacaggtcgcccgcaacttttttttgacgcgggataaaactattatccgcaag
gtaaaggaaatctttatttcttttcacattgaggatctgctcacaaaagatgaaattctt
gaactgtacgtaaatcgcatctacctcggccagcgtgcttacggtgttggcgcggcggcg
caggtgtattacggcaaggatttgcacgacctctcattggcagaaatggcggttattgcc
ggcctgcccaaagcgccttccacccttaaccccatcacctcgcccgaccgcgcgctcgcg
cgtcgtaatgtagtgttgatgcggatgcgggaagtcggtttcattaacgacagcgaatac
gccagcgccatcgagcagcccaataccgcctcttatcatggtgccgaaatcgacctgtac
gtgccttatgtgtctgaaatggcgcgggactatatgatccaaaagtatggcgaagaggaa
gcctataccggcggctataacgtttacaccaccgtcagttccgacctgcaactcaaagcc
caaaaggcactgcgcgacaatatctacgcctacgatgaacgccatggctaccgcggtggc
gccgaagtgctgtggagcagtgaggtgccagacaccgccagcatcagtgagcgactgaag
aaaatcgccaacgtacaggatcttgagcctgcggccgtgataaacgtccaggagcagcaa
gcgactgtgctgcgcggcaacggcgaaaccgtgacactgccatggcagggcatccaatgg
gcgcgcaagtttattactgacacccgtcagggcagtgcccccaaggctgccaccgaggtg
ctgactgccggcgagcgtatctggatccgtaacaatggcgaacactggcagctgtcacag
gtgccggaagtctccagcgccatcgtatccctcgacccacataacggcgccatccgcgca
ctggtgggcggttacagcttcagtcagagccagttcaaccgggtgacccaggccaaacgc
cagcttggttccaacatcaagccctttatctacgccgctacgctggagaaaggctttacc
ctggccacgctgataaacaacgcccctatcaacaagcccgacatgagtcagggtaccgcc
tggcgacccaagaactcacccgacgtatacacaggcccaacccggatgcgcgtgggtctg
gcccagtcaattaacgtcatggccgtacgggcgctgcgttatgccggtatcgacaatact
gtcgagctgctgacccgctttggcttcgaccccaacgacctgccccgcaacgagtcgctg
gctctgggttcgccttcggttactccgctgcaggtggtcaatgctttctcggtgttcgcc
aacggcggctatctggttgagcccttctttatcgaccgggtcgaaaccgcccttggtcag
gtagtggagaagaccaagccaacattggcctgcgatgcaccaatgccggaagaaacgccg
gaagatcaggtgctcagccaacagccagactcggtagttgaagccctggccacggccgcc
attaccggcgaggcgccagaaatgctggcgaaagccaccgacgtgaatctgtgcggcggc
gaaggcgtgcgttacgcgccccgagtgctgtcggagcaaaacgccttcctgattaccgaa
gcgctcaagagtgtgatttggggcggcggtgatttcagcaagggcaccggctggaacggt
accgcatggcgcgcggctcgcctgctcaaacgccatgatatcgctggtaaaacaggtaca
accaacgagtcgcgtgatacctggttcagtggtttcaaccctgacttggttaccaccgtc
tgggttggctttgacgaccacggccgcgaacttggccgcaccgcctggaatgccaacggc
gccaaagaccagatctccggtgccgaggccggcgccaaaaccgcgggtcccgcctggaac
cagtttatgctgatggcaattggtgacatcccggagaagccttctcagccgcctgccggc
atagtctcggcccgtatcgattacagttcgggcaagctgagtcgtcgcaccgactacacc
agtggcttcgagtacttcgccgccggcacagtgccaacagattacgccaactccgctatc
gccgaagacaacaccacggcgccggaaaccacggcagacgatctgttccagtaa

DBGET integrated database retrieval system