KEGG   Shewanella khirikhana: STH12_02996
Entry
STH12_02996       CDS       T06711                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
skh  Shewanella khirikhana
Pathway
skh00520  Amino sugar and nucleotide sugar metabolism
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STH12_02996 (murA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_02996 (murA)
Enzymes [BR:skh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     STH12_02996 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   STH12_02996 (murA)
SSDB
Motif
Pfam: EPSP_synthase
Other DBs
NCBI-ProteinID: AZQ12060
UniProt: A0A3S9L8Z6
LinkDB
Position
complement(3393308..3394564)
AA seq 418 aa
MDKLAIQSGGSLAGRVVISGAKNAALPILMAGVLAESEFVLTNVPSLRDVDTSCKLLRCL
GAEVTQDGDRIAINTANIDHFVAPYDLVKTMRASILILGPLLARFGKADVSLPGGCAIGA
RPVNLHLHGLEQMGAKIEVKEGYIKARVDGRLKGAHIFMDMVSVGATENLLMAAALADGV
TVIENAAREPEVIDLANCLVAMGAQISGIGTATLKITGVERLRGCDYRVMPDRIETGTFL
VAAAVTRGSIRCDNADPSSLEAVLAKLEDAGADIRTGDDWIELDMKGQRPKAVNIKTAPY
PAFPTDMQAQFCVLNCLAEGTGTITETIFENRFMHVPELMRMGANMELEGHTCIVHGVER
LSGAQVMATDLRASASLVIAGLMADGTTVVDRIYHLDRGYEHIENKFKGLGGQVIRMK
NT seq 1257 nt   +upstreamnt  +downstreamnt
gtggataaactcgctattcagtccggcggatcccttgccggacgtgttgttatttccgga
gccaaaaacgccgccctgcctattttgatggcgggggtgttggccgaatccgaatttgta
ctgaccaacgtacccagcctgcgcgacgtggataccagctgtaagctgctgcgctgtctt
ggcgctgaagtgactcaggatggcgatcgcattgccatcaacaccgccaatatcgatcac
ttcgttgccccttacgatctggtgaaaaccatgcgggcctcgattttgatcctcgggccg
ctgcttgcccgttttggtaaagccgatgtgtccctgcccggtggctgtgccatcggtgcc
cgtcctgtgaacctgcacctgcatggtctggagcagatgggcgccaaaatcgaagtgaaa
gaaggttatatcaaggctcgggtggatggccgcttgaaaggcgcacatatctttatggat
atggtcagcgtgggcgcgactgaaaacctgctgatggcagcggcgcttgccgacggcgtg
accgtgattgaaaacgccgcccgcgaacctgaggtgattgacctggccaactgtctggtt
gccatgggtgctcaaatcagcggtattggcactgccactttgaaaatcaccggcgttgag
cgtctgcgcggctgtgattaccgggtaatgcccgaccgtatcgaaaccggcaccttcctg
gtggctgctgctgttacccgtggcagcatccgctgtgacaatgccgatccttcgtctctg
gaagccgttttggccaagctggaagacgccggcgccgatatccgcaccggtgacgattgg
attgagcttgatatgaagggccagcgcccgaaagcggtcaatatcaagaccgcgccctat
ccagcgttcccgaccgacatgcaggcgcagttttgtgtgcttaactgtttggctgaaggc
acaggcaccatcactgaaaccatcttcgagaaccgttttatgcacgtgcctgagctgatg
cgtatgggcgcgaacatggagcttgaaggtcacacctgcattgtgcacggggtggagcgt
ttgagtggtgctcaggtgatggcaacggatctgcgcgcttcggccagtctggtgatcgcc
ggtctgatggccgacggcaccactgtggttgaccgtatttaccacctcgaccgtggctat
gaacatatagaaaataagtttaagggcctcggcggtcaggtcatccgaatgaagtaa

DBGET integrated database retrieval system