KEGG   Shewanella khirikhana: STH12_03891
Entry
STH12_03891       CDS       T06711                                 

Gene name
murB
Definition
(GenBank) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
skh  Shewanella khirikhana
Pathway
skh00520  Amino sugar and nucleotide sugar metabolism
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STH12_03891 (murB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_03891 (murB)
Enzymes [BR:skh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     STH12_03891 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   STH12_03891 (murB)
SSDB
Motif
Pfam: MurB_C FAD_binding_4
Other DBs
NCBI-ProteinID: AZQ12937
UniProt: A0A3Q9E8Q7
LinkDB
Position
4388931..4390031
AA seq 366 aa
MWDWQFLSVANALNATLGYNGFLFVAESGMPVSLKSYNTFGIDHQCAELIEVTDAAELPA
LIHELDARGQSFFVLGGGSNVVLTSDIDTTVLKMANKGIEVLEDESAWHLSVAAGENWHE
LVSWTLEKQMPGLENLALIPGTVGAAPIQNIGAYGVELMDVCEWVEYLSLPECVTVRLTA
AECQFGYRDSIFKQQLNGKAIITRVGFKLPKLWQPKLNYGPLAEFGMDTVTPKMIFERVI
AVRSEKLPDPARLGNAGSFFKNPIVDAATFASIVKQYPDAVAYALEDGRMKLAAGWLIDK
AGLKGFRLGEAGVHDKQALVLVNFGNASGKDILKLAKHVIDEVHTRFGVQLEAEPNVVGR
FSLLND
NT seq 1101 nt   +upstreamnt  +downstreamnt
ttgtgggattggcagtttctgtctgtcgctaatgcgctgaatgccacccttggttacaat
ggctttttattcgtggcggaaagcggtatgcctgtttctctcaagtcctataataccttt
ggtatcgatcatcagtgtgctgagcttattgaggtcaccgatgccgctgagttgccagcg
cttattcatgagctggatgcgcgcggtcagtcattctttgttctcggtggcggcagcaat
gtggtgctgacatcggacatagataccactgtgctcaagatggcaaataagggaatagag
gtccttgaggatgagtctgcctggcatttaagtgtggctgccggcgaaaactggcatgag
ctggtgagctggactcttgaaaagcagatgccgggacttgagaacctggcgcttattcca
ggcactgttggcgcagcccctattcagaacataggcgcctatggtgttgagctgatggat
gtctgtgagtgggttgagtacctgtcgctgccagagtgcgtgactgtcaggctgacggcc
gccgagtgccagtttggctaccgagattccatctttaaacagcagcttaacggtaaagct
attattacccgggtcggctttaagttgcctaagttgtggcagcccaaactgaattatggc
ccgctggctgagtttggcatggatacagtgacgccgaagatgatcttcgagcgggtgata
gccgtgcgctcagagaagcttcccgatcctgccaggctggggaatgccggtagctttttt
aagaatcctattgtggatgccgcaacctttgcgagcatagtaaagcagtatcccgatgct
gtggcttacgccctggaagatggccggatgaaactggccgctggctggctgattgataaa
gcgggcttgaaaggctttcgattgggcgaggcgggcgtgcatgataaacaggcgctggtg
ctggttaactttggaaatgccagcggcaaagatatccttaaactcgccaaacatgttatc
gatgaggtgcatactcgctttggggtgcaacttgaagctgagcccaatgtggtgggccga
ttttcactcttaaacgattaa

DBGET integrated database retrieval system