KEGG   Shewanella khirikhana: STH12_04039
Entry
STH12_04039       CDS       T06711                                 

Gene name
murE
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
skh  Shewanella khirikhana
Pathway
skh00300  Lysine biosynthesis
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    STH12_04039 (murE)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_04039 (murE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_04039 (murE)
Enzymes [BR:skh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     STH12_04039 (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Precursor biosynthesis
  Amino acid ligase
   STH12_04039 (murE)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: AZQ13073
UniProt: A0A3Q9E8V9
LinkDB
Position
4574791..4576254
AA seq 487 aa
MMLLKDLLAPWFHYAGTESVNAPVLDSRQVSEGGLFVAIPGHAVDGRNFIGAALAKGAAA
VLTHTDDPAAHGLVEREQGLVIHFFQLSRQVSALARQYYELTPGKLHTVGITGTNGKTSV
SQLIAQLSEQLGSRAAVMGTLGNGLWGELEDVGNTTADPIRVMADLHHFETRGAGVCAME
VSSHGLVQGRVEAVPFEVAVFTNLSRDHLDYHGDMENYGAAKRRLFAFGSLKASVINLDD
AVGEGWFAGMGHAVGFSCEGHPKAAWRFEQARFHHAGFSATLVCPEGEFALECRLLGAFN
LSNLLAALCVMNQLGYSADSLVQAAAKLTPVPGRMECFPCADGLSLVVDYAHTPDAIEQA
LKAARHHCEGQLWIVFGCGGDRDKGKRPLMAAAAERFADQLVLTSDNARSEDPQAILDDM
KAGLKTPEDALFEVDRIQAIRRAVALAKPGDLILLAGKGHETYQEIAGVKHQYDERALAK
ALCEEKS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgatgctgttgaaagatttattggcgccctggttccactatgccggtactgaaagtgtt
aatgcgcctgtgctcgacagtcgtcaggtcagcgaaggcggcctgtttgtggccattccc
ggccatgccgtcgatggccgcaattttatcggtgccgcccttgcaaaaggcgccgcggca
gtactgactcacacagatgaccctgcggcccatggtttggtggagcgtgagcaggggctg
gtgatccatttcttccagctcagccgtcaggtgtcggcgctggcccgtcaatactatgag
ctgacacccggcaagctgcacacagtcggtatcacagggaccaatggcaagacctcggtc
agccaactgattgcccagctttctgagcagctcggcagccgcgcagcggtaatgggtacc
ctcggcaatggcctgtggggcgagcttgaagatgtgggtaacaccaccgccgaccccatt
cgggtgatggcggatttacaccatttcgaaacgcgtggcgccggggtatgtgccatggaa
gtctccagccacgggttggtgcagggacgggttgaagccgttccctttgaagtggcggta
tttaccaacttaagccgcgaccacctggattaccacggtgacatggaaaactacggcgct
gccaaacgtcgtctgttcgccttcggcagccttaaggccagtgtgatcaacctggacgac
gccgtaggcgaaggctggtttgccggaatggggcacgcggtaggtttcagctgcgaaggg
catcccaaggccgcctggcggtttgagcaggcccgcttccatcatgccggattcagcgcc
accctggtgtgccccgaaggtgaatttgccctcgagtgccgtctgcttggtgcctttaac
ctgtccaacctgctcgctgccctgtgcgtgatgaaccagcttggttacagcgccgactct
ctggtgcaggcggctgcaaaactgacgccggtacccggtcggatggagtgtttcccctgc
gcagatggtctgtcgctggtggtcgattacgcccacaccccggatgccatcgagcaggcg
ctcaaggcggcgcgtcatcactgcgaaggccagctgtggattgtatttggctgcggcggc
gatcgcgataaaggcaagcgtcctttgatggcggcagctgccgagcgttttgccgatcag
ctggtgctgacttccgacaatgcccgcagtgaagatccgcaggccattctcgatgatatg
aaggccggactgaaaacgcccgaagatgcgctgttcgaagtagaccgcattcaggctatc
cgccgcgctgtggcgctggccaaacccggcgaccttatcctgctggccggtaaaggccat
gaaacctatcaggaaattgccggcgtgaaacaccaatacgatgaacgcgccctggcaaag
gcgctttgtgaggagaaatcgtga

DBGET integrated database retrieval system