KEGG   Shewanella khirikhana: STH12_04040
Entry
STH12_04040       CDS       T06711                                 

Gene name
murF
Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
skh  Shewanella khirikhana
Pathway
skh00300  Lysine biosynthesis
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
skh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    STH12_04040 (murF)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_04040 (murF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    STH12_04040 (murF)
Enzymes [BR:skh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     STH12_04040 (murF)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Other DBs
NCBI-ProteinID: AZQ13074
UniProt: A0A3S9LBT7
LinkDB
Position
4576251..4577618
AA seq 455 aa
MIPLKLSELANATDGTLLGEDVVIHHLSSDSRQMTPGSLFVALKGERFDGHAFADKAVEL
GASALLVERELPFAVPQLLVADPQKAMGRIGALVRDRVNPVCVALTGSNGKTSVKEMVAT
VLAQRHSVLFTAGNFNNEIGVPLTLLRLEAGHEFGVFELGANHKGEIDYTSSLVRPRVSL
VNNVGSAHLEGFGSEAGVAQAKSEIYRHLAEDGVGIVNADDSYADVMLAKLQGKQVLRFG
LGSDADVTAREVACDAFGRHSFVLCHGGSHARVTLPLAGRHQVHNALATAAICIALGLAL
DEIAQGLGKLAPVKGRMLPVALGRITVVDDTYNANPNSVGVAIDWLKEICANRILVLGDL
GELGDNAALLHGQLGERAKEAGLDSLFCLGSLSRHASEAFGSEHFVELDALVSNLIKHIN
GVDGKVTLLVKGSRSAAMERVVEALTAAHGRGELV
NT seq 1368 nt   +upstreamnt  +downstreamnt
gtgatcccgctgaagttgtcagaactggccaatgcaaccgacggtaccctgctgggtgag
gatgtagtcatacatcacttaagcagtgacagccgccaaatgaccccgggcagcctgttt
gtggcgctcaagggcgagcgttttgatggccatgcctttgctgacaaagcggttgagctg
ggcgccagcgccttgctggttgagcgtgaattgccgttcgccgtgccgcaattgctggtt
gctgacccgcagaaagccatggggcgtatcggcgcgctggtgcgtgaccgcgtcaatccg
gtatgtgtggcgctcaccggctccaacggcaagaccagcgtgaaagaaatggtagccaca
gtgctggcacagcgtcactcggtactcttcaccgcaggtaatttcaacaacgaaatcggc
gtgccgctgaccttgctgcgcctcgaagcgggccacgagtttggcgtatttgagctgggc
gccaaccacaagggtgaaatcgattacacctcttcattggtgcgcccaagggtgtcgctg
gtcaacaacgtcggcagcgcgcatctggaaggttttggctcagaggccggtgtggcccag
gccaagtcagagatttaccgccatctggccgaggacggtgtgggcatagtgaatgccgac
gacagctacgccgatgtgatgctcgccaaattgcagggcaaacaggtgctgcgctttggt
cttggcagtgatgccgacgtgaccgcccgtgaagtagcctgtgatgcctttggtcgtcac
agctttgtgctctgtcatggcggcagccatgccagggtgaccttgccactggccggacgc
catcaggtacataacgcgctggccaccgcggccatttgtattgcccttgggctggcactc
gatgagattgcccaaggccttggcaagctcgctcctgtgaagggccgcatgctgccagtg
gcgcttggtcgtatcactgtggtggacgacacctacaatgccaaccccaactcggttggc
gtcgccatcgactggctgaaggaaatttgtgcaaaccggatcctggtactgggcgatttg
ggtgaattgggcgacaatgctgcccttttgcatgggcaactgggtgagcgggcgaaggaa
gccggtctcgacagtctgttttgccttggcagcttaagccgccatgccagtgaggcattc
ggcagcgaacacttcgtggagctggatgctctggtgagcaatttgattaaacatatcaac
ggggtagatggaaaagtgaccctgttggtgaaggggtctcgcagcgccgccatggagcgg
gttgttgaggccttaacggccgcccacgggcgcggggagttagtataa

DBGET integrated database retrieval system