KEGG   Shewanella khirikhana: STH12_04044
Entry
STH12_04044       CDS       T06711                                 

Gene name
murG
Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
skh  Shewanella khirikhana
Pathway
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
skh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_04044 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    STH12_04044 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_04044 (murG)
Enzymes [BR:skh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     STH12_04044 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Precursor biosynthesis
  Glycosyltransferase
   STH12_04044 (murG)
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_2
Other DBs
NCBI-ProteinID: AZQ13078
UniProt: A0A3Q9EAI8
LinkDB
Position
4581234..4582316
AA seq 360 aa
MGPQSGKRLLVMAGGTGGHVFPALAVARRLASEGWQVRWLGTADRMEARLVPQHGFDIDF
IDIQGVRGNGLLRKLAAPVKILRSVMQARKVIQSFKPDVVLGMGGFASGPGGVAAKLCGI
PLVLHEQNAIPGMTNKLLSRIASRVLCAFDGAFGTQGQTVGNPIRDELVALGAKPRQVQS
DALKVLVVGGSLGAKVFNDLMPAVTARLAQEQAVTVWHQTGKNNLAAVQAAYQELGQDGG
VNIAEFIDDMEAAYRWADVVLCRAGALTVSELAAVGLPSILVPYPHAVDDHQTMNARVLV
DAGAAFLVPQPIASTELLADKLRLLAGDREELTRMGERARAAAVLDATERVADVCRELAK
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgggcccgcagtcaggaaaacgtcttttggtgatggccggtggtaccggtggtcacgta
tttcctgcgctggcggtggcacgtcgtttggcgagtgaaggctggcaggttcgctggttg
ggcaccgccgatcgtatggaggctcgtctggttccgcagcatggtttcgatatcgacttt
atcgatattcagggcgtgcgtggaaatggtttgctgcgcaagctggcggcgccggtgaaa
atcctgcgctcagtgatgcaggccagaaaggttatccaaagctttaagccggatgtggtg
ctgggcatgggcggtttcgccagtggtccgggcggcgtggctgccaagctgtgcggcatc
ccgctggtgctgcatgagcaaaatgccattccggggatgactaataagcttttgtcccgc
attgccagtcgggtgttgtgcgcctttgacggtgcttttggcactcaggggcaaaccgtg
gggaatccgattcgggatgagctggtggccctgggcgccaaaccccgccaggtgcagagc
gatgcgctcaaggtgctggtggttggcggcagccttggcgccaaggtattcaatgacctg
atgcctgccgtgacggcacgtttggcgcaggagcaggccgtgaccgtctggcatcagacc
ggcaagaacaacctggcggccgtacaggcggcataccaggagctggggcaggacggtggc
gtgaatatcgctgaatttattgatgatatggaagcggcttaccgctgggccgatgtggtg
ctgtgccgggccggcgccctgacagtttccgaactggcggcggtgggattgccgagcatt
ctggtgccttatccccatgcggtggatgaccatcagaccatgaacgccagagtgctggtg
gatgccggtgcggccttcttggtgcctcagcctatcgcttccaccgagctattggccgac
aagctcagattgcttgccggcgaccgtgaagaattgacccgtatgggtgaaagagccaga
gcggctgccgtattggatgccaccgagcgggtggctgacgtttgccgcgagctggctaag
taa

DBGET integrated database retrieval system